DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and Tmprss2

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_008766769.1 Gene:Tmprss2 / 156435 RGDID:620766 Length:580 Species:Rattus norvegicus


Alignment Length:242 Identity:91/242 - (37%)
Similarity:130/242 - (53%) Gaps:28/242 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCV-NTLSGPENLTIVAG--SSNI 96
            |||||...:...:|.|:|:..:|.|.|||:|.....|::||||| ..||.|...|..||  ..::
  Rat   253 RIVGGSTASPGDWPWQVSLHVQGIHVCGGSIITPEWIVTAAHCVEEPLSSPRYWTAFAGILKQSL 317

  Fly    97 WFPTGPQQELEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPI---------ELAKERPD 152
            .| .|.:.::|  ::|.||.|.:...:.|.|::.|.....|||.|:|:         :||:|   
  Rat   318 MF-YGSRHQVE--KVISHPNYDSKTKNNDIALMKLQTPLAFNDVVKPVCLPNPGMMLDLAQE--- 376

  Fly   153 HDTPVTVTGWGTTSEGGTISDVLQEVSVNVVDNSNC--KNAYSIMLTSRMLCAGVNGGGKDACQG 215
                ..::|||.|.|.|..||||....|.:::.|.|  |..|:.::|..|:|||...|..|:|||
  Rat   377 ----CWISGWGATYEKGKTSDVLNAAMVPLIEPSKCNSKYIYNNLITPAMICAGFLQGSVDSCQG 437

  Fly   216 DSGGPLVYNNT----LLGIVSWGTGCAREKYPGVYCSVPDVLDWLVE 258
            |||||||....    |:|..|||:|||:...||||.:|....||:.:
  Rat   438 DSGGPLVTLKNEIWWLIGDTSWGSGCAKAYRPGVYGNVTVFTDWIYQ 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 89/237 (38%)
Tryp_SPc 36..259 CDD:238113 90/241 (37%)
Tmprss2XP_008766769.1 LDLa 112..147 CDD:238060
SRCR_2 152..247 CDD:292133
Tryp_SPc 253..482 CDD:214473 90/238 (38%)
Tryp_SPc 254..485 CDD:238113 90/241 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.