DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and Gzmk

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_032222.1 Gene:Gzmk / 14945 MGIID:1298232 Length:263 Species:Mus musculus


Alignment Length:237 Identity:73/237 - (30%)
Similarity:118/237 - (49%) Gaps:10/237 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SLADPIYRNEEVHIPKLDGRIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCVNT 80
            ||...:|.:.|.    ....|:||::......|...|::||..|.|||.:.....:::||||.:.
Mouse    10 SLVAGVYMSSEC----FHTEIIGGREVQPHSRPFMASIQYRSKHICGGVLIHPQWVLTAAHCYSW 70

  Fly    81 LSGPENLTIVAGSSNIWFPTGPQQELEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIE 145
            .....:.|:|.|:.::......:|..|:::.|...:.::.:..:|..::.|....|.|..||.:.
Mouse    71 FPRGHSPTVVLGAHSLSKNEPMKQTFEIKKFIPFSRLQSGSASHDIMLIKLRTAAELNKNVQLLH 135

  Fly   146 LAKERPDHD-TPVTVTGWGTTS-EGGTISDVLQEVSVNVVDNSNCKNA----YSIMLTSRMLCAG 204
            |..:....| |...|||||||. :..|.||.|:||:|.::....|.:.    :..::|..|:|||
Mouse   136 LGSKNYLRDGTKCQVTGWGTTKPDLLTASDTLREVTVTIISRKRCNSQSYYNHKPVITKDMICAG 200

  Fly   205 VNGGGKDACQGDSGGPLVYNNTLLGIVSWGTGCAREKYPGVY 246
            ...|.||:|:|||||||:.......:||.|..|...|.||:|
Mouse   201 DARGQKDSCKGDSGGPLICKGIFHALVSQGYKCGIAKKPGIY 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 69/218 (32%)
Tryp_SPc 36..259 CDD:238113 69/217 (32%)
GzmkNP_032222.1 Tryp_SPc 25..253 CDD:214473 69/218 (32%)
Tryp_SPc 26..256 CDD:238113 69/217 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.