DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and PRSS36

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_775773.2 Gene:PRSS36 / 146547 HGNCID:26906 Length:855 Species:Homo sapiens


Alignment Length:254 Identity:83/254 - (32%)
Similarity:116/254 - (45%) Gaps:19/254 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PKLDGRIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCV---NTLSGPENLTIVA 91
            |:...|||||.:.....:|.|:|:.:.|.|.|||::...:.::|||||.   .||......:::.
Human    41 PEPSARIVGGSNAQPGTWPWQVSLHHGGGHICGGSLIAPSWVLSAAHCFMTNGTLEPAAEWSVLL 105

  Fly    92 GSSNIWFPTGPQQELEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIEL--AKERPDHD 154
            |..:...|........|..|::...|..:....|.|:|.|........||.|:.|  |..|..|.
Human   106 GVHSQDGPLDGAHTRAVAAIVVPANYSQVELGADLALLRLASPASLGPAVWPVCLPRASHRFVHG 170

  Fly   155 TPVTVTGWGTTSEGG--TISDVLQEVSVNVVDNSNCKNAYS--------IMLTSRMLCAGVNGGG 209
            |....||||...|..  .:..|||||.:.::..:.|:..||        :.:...|||||...|.
Human   171 TACWATGWGDVQEADPLPLPWVLQEVELRLLGEATCQCLYSQPGPFNLTLQILPGMLCAGYPEGR 235

  Fly   210 KDACQGDSGGPLVYNN----TLLGIVSWGTGCAREKYPGVYCSVPDVLDWLVETVADKE 264
            :|.||||||||||...    ...||.|:|.||.|...|||:.:|.....|:.|.|...|
Human   236 RDTCQGDSGGPLVCEEGGRWFQAGITSFGFGCGRRNRPGVFTAVATYEAWIREQVMGSE 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 78/238 (33%)
Tryp_SPc 36..259 CDD:238113 78/241 (32%)
PRSS36NP_775773.2 Tryp_SPc 46..286 CDD:214473 78/239 (33%)
Tryp_SPc 47..289 CDD:238113 78/241 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..316 1/3 (33%)
Tryp_SPc 330..538 CDD:304450
Tryp_SPc 601..783 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149418
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.