DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and CG12256

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster


Alignment Length:247 Identity:79/247 - (31%)
Similarity:124/247 - (50%) Gaps:35/247 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RIVGGQDTNITQY-PHQISMRY-----RGNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGS 93
            |:|||.|....:| |:|:||::     :..|.|||::...|::::||||||. .....:::|||.
  Fly    46 RVVGGYDVPEDEYVPYQVSMQFLTRSGKMRHFCGGSLIAPNRVLTAAHCVNG-QNASRISVVAGI 109

  Fly    94 SNIWFPTGPQQELEVREIIIHPKYRTLNNDY------DAAILILDGDFEFND-AVQPIELA-KER 150
            .::...:|.:.:::..|         :|.:|      |.|||.:|..||.:: .|..|::: .:.
  Fly   110 RDLNDSSGFRSQVQSYE---------MNENYQELVTSDIAILKIDPPFELDEKRVSTIDVSGSDM 165

  Fly   151 PDHDTPVTVTGWGTTSEGGT-----ISDVLQEVSVNVVDNSNCKNAYSIMLTSRMLCAGVNGGGK 210
            ...|..|.:||||:....||     ...|||::....:.||.||...: .||...:|| :...||
  Fly   166 VGADQEVLLTGWGSVFHFGTGPFAKYPTVLQKLDYKTLSNSKCKETMT-QLTDTEICA-LERFGK 228

  Fly   211 DACQGDSGGPLVYNN----TLLGIVSWGTGCAREKYPGVYCSVPDVLDWLVE 258
            .||.||||||||..:    ..:|:||:||.......|.||..|.....|:.|
  Fly   229 GACNGDSGGPLVMKSGESYKQVGVVSYGTAFCASNNPDVYTRVSMFDGWIKE 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 77/242 (32%)
Tryp_SPc 36..259 CDD:238113 78/246 (32%)
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 77/243 (32%)
Tryp_SPc 47..280 CDD:238113 77/244 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.