DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and PRSS58

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001001317.1 Gene:PRSS58 / 136541 HGNCID:39125 Length:241 Species:Homo sapiens


Alignment Length:214 Identity:55/214 - (25%)
Similarity:99/214 - (46%) Gaps:30/214 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 CGGTIYRSNQIISAAHC----VNTLSGPENLTIVAGSSNIWFPTGPQQELEV---REIIIHPKYR 118
            |.|.:.....:|:||||    :..:.|   :||.|.|:        ::.|:|   .::|.||.:.
Human    41 CAGVLIHPLWVITAAHCNLPKLRVILG---VTIPADSN--------EKHLQVIGYEKMIHHPHFS 94

  Fly   119 TLNNDYDAAILILDGDFEFNDAVQPIELAKERPDHDTPVTVTGWGTTSEGGTISDV------LQE 177
            ..:.|:|..::.|..:.|.||.|:...|..:....:|..:|:.|..     .:.|:      ||.
Human    95 VTSIDHDIMLIKLKTEAELNDYVKLANLPYQTISENTMCSVSTWSY-----NVCDIYKEPDSLQT 154

  Fly   178 VSVNVVDNSNCKNAY-SIMLTSRMLCAGVNGGGKDACQGDSGGPLVYNNTLLGIVSWGTGCAREK 241
            |:::|:....|::|| :..:|..|||.|:..|.:..|:..|..|.:.|..|.||:|:..||....
Human   155 VNISVISKPQCRDAYKTYNITENMLCVGIVPGRRQPCKEVSAAPAICNGMLQGILSFADGCVLRA 219

  Fly   242 YPGVYCSVPDVLDWLVETV 260
            ..|:|..:...:.|:...:
Human   220 DVGIYAKIFYYIPWIENVI 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 54/207 (26%)
Tryp_SPc 36..259 CDD:238113 55/211 (26%)
PRSS58NP_001001317.1 Tryp_SPc 29..234 CDD:214473 54/208 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.