DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and Ctsg

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_031826.1 Gene:Ctsg / 13035 MGIID:88563 Length:261 Species:Mus musculus


Alignment Length:263 Identity:75/263 - (28%)
Similarity:123/263 - (46%) Gaps:32/263 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ILVVFLVLGVGCSLADPIYRNEEVHIPKLDGRIVGGQDTNITQYPHQISMRYR---GNHRCGGTI 65
            :|:.|::|           :.:|.      |:|:||::.....||:...:..:   |...|||.:
Mouse     6 LLLTFILL-----------QGDEA------GKIIGGREARPHSYPYMAFLLIQSPEGLSACGGFL 53

  Fly    66 YRSNQIISAAHCVNTLSGPENLTIVAGSSNIWFPTGPQQELEVREIIIHPKYRTLNNDYDAAILI 130
            .|.:.:::||||:.:     ::.:..|:.||......||.:.|...|.||.|...|...|..:|.
Mouse    54 VREDFVLTAAHCLGS-----SINVTLGAHNIQMRERTQQLITVLRAIRHPDYNPQNIRNDIMLLQ 113

  Fly   131 LDGDFEFNDAVQPIEL--AKERPDHDTPVTVTGWGTTSEG-GTISDVLQEVSVNVVDNSNCKNAY 192
            |......:.:|:|:.|  |.::.......||.|||..|:. ||  :|||||.:.|..:..|.|.:
Mouse   114 LRRRARRSGSVKPVALPQASKKLQPGDLCTVAGWGRVSQSRGT--NVLQEVQLRVQMDQMCANRF 176

  Fly   193 SIMLTSRMLCAGVNGGGKDACQGDSGGPLVYNNTLLGIVSWGTGCAREKYPGVYCSVPDVLDWLV 257
            ....:...:|.|.....|.|.:||||||||.:|...||||:|:.....  |.|:..:...:.|:.
Mouse   177 QFYNSQTQICVGNPRERKSAFRGDSGGPLVCSNVAQGIVSYGSNNGNP--PAVFTKIQSFMPWIK 239

  Fly   258 ETV 260
            .|:
Mouse   240 RTM 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 68/225 (30%)
Tryp_SPc 36..259 CDD:238113 69/228 (30%)
CtsgNP_031826.1 Tryp_SPc 20..238 CDD:214473 68/226 (30%)
Tryp_SPc 21..241 CDD:238113 69/228 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.