DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and AgaP_AGAP001244

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_321898.3 Gene:AgaP_AGAP001244 / 1281920 VectorBaseID:AGAP001244 Length:279 Species:Anopheles gambiae


Alignment Length:211 Identity:75/211 - (35%)
Similarity:110/211 - (52%) Gaps:18/211 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSSNIWFP 99
            :||||:..:|..:.:|:|:|....|.||.:|..|...::||||:.....|..::::||       
Mosquito    53 KIVGGEPVSIETHVYQLSLRSYDYHICGASIISSVWALTAAHCLFPDPDPRTISLLAG------- 110

  Fly   100 TGPQQE----LEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDA--VQPIELAKERPDHDTPVT 158
            ||.|..    .....|||||.|.....|.|.|::.::..|...:.  :..:.|..| |.......
Mosquito   111 TGSQSTGGRIYNATRIIIHPMYAPSTMDNDVAVIRVNTHFSGPNTGYIGVVPLGYE-PMAGVRAI 174

  Fly   159 VTGWGTTSEGGTISDVLQEVSVNVVDNSNCKNAYS-IMLTSRMLCAGVNGGGKDACQGDSGGPLV 222
            |||||..|||...|..|..|.:.:||.:.|.:.:| ::::.:|:|||..  |||:|.||||||||
Mosquito   175 VTGWGRQSEGAKQSMTLAGVEIPIVDKAECMDQWSGVLVSPQMICAGEL--GKDSCNGDSGGPLV 237

  Fly   223 YNNTLLGIVSWG-TGC 237
            .....:|||||| |.|
Mosquito   238 SGGRQIGIVSWGSTKC 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 75/211 (36%)
Tryp_SPc 36..259 CDD:238113 75/210 (36%)
AgaP_AGAP001244XP_321898.3 Tryp_SPc 53..266 CDD:214473 75/211 (36%)
Tryp_SPc 54..276 CDD:238113 75/210 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.