DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and AgaP_AGAP001366

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_321777.4 Gene:AgaP_AGAP001366 / 1281814 VectorBaseID:AGAP001366 Length:563 Species:Anopheles gambiae


Alignment Length:258 Identity:72/258 - (27%)
Similarity:117/258 - (45%) Gaps:36/258 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 IPKLDGRIVGGQDTNITQYPHQISMRYRG-----NHRCGGTIYRSNQIISAAHCVNTLSGPENLT 88
            :||.:..:..|..:...|:|...:: ||.     .:.||.|:......|:||||| ||. ..:..
Mosquito   308 VPKANPLVTHGTVSERGQFPWHGAL-YRSTVTELKYLCGATLISRRASITAAHCV-TLE-KSSKP 369

  Fly    89 IVAGSSNIWFP-------TGPQQELEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIEL 146
            :.|||..::|.       .||:::.::|.|.|..:|:......|.|:|:|..|.::::.|:|:.|
Mosquito   370 VDAGSLLLYFGKIDLSKWNGPEEDAQIRSIHIPAQYQHERFFNDIAVLVLKEDIKYSNFVRPVCL 434

  Fly   147 AKERPDHDTPVT----VTGWGTTSEGGTISDVLQEVSVNVVDNSNC----KNAYSIMLTSRMLCA 203
            .....|:.|.:.    |.||| .:|.|.:|..|....:.||.:..|    ::.:|.:.:....||
Mosquito   435 WNFDDDYKTLINKIGFVPGWG-YNEHGLVSSRLSFAQMPVVAHETCIWSNRDFFSKVTSDTSFCA 498

  Fly   204 GVNGGGKDACQGDSGGPLVY--NNT--LLGIVSWGTG------CAREKYPGVYCSVPDVLDWL 256
            |.. .|...|.|||||.:|:  ||.  |.||||....      |..:.|. |:........|:
Mosquito   499 GFK-NGTSVCNGDSGGGMVFKHNNLWYLRGIVSVSAALQDRFHCDSKHYV-VFTDAAKFTSWI 559

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 69/249 (28%)
Tryp_SPc 36..259 CDD:238113 70/251 (28%)
AgaP_AGAP001366XP_321777.4 GD_N 15..124 CDD:292649
Tryp_SPc 315..560 CDD:238113 70/251 (28%)
Tryp_SPc 315..559 CDD:214473 69/249 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.