DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and AgaP_AGAP001395

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_321740.5 Gene:AgaP_AGAP001395 / 1281782 VectorBaseID:AGAP001395 Length:268 Species:Anopheles gambiae


Alignment Length:259 Identity:93/259 - (35%)
Similarity:125/259 - (48%) Gaps:30/259 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHC----VNTLSGPENLTIVAGSSN 95
            |||||.::|..|..:..|:..||.|.||.:|.....:::|.||    ||.:.....:..|.|...
Mosquito    11 RIVGGVNSNRGQITYIASLTKRGGHFCGASIVNDRWLLTAGHCVCSGVNKILRANQIQAVLGLYR 75

  Fly    96 IWFPTGPQ----------QELEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIELA--- 147
            .....|.|          .|:.:|.|:.||.|.......|.|:|.|....:|:.:|:||.|:   
Mosquito    76 RSEFGGNQIDSDPFSDRAYEVGIRTIVPHPGYVCNKPSNDIALLELARRIDFSASVRPICLSSGA 140

  Fly   148 --KERPDHDTPVTVTGWGTTSEG---GTISDVLQEVSVNVVDNSNCKNAY-----SIMLTSRMLC 202
              ..|.:..|.| |.|||...|.   |..:|.||...|:|..|..|::.|     |..:....||
Mosquito   141 DGSARVEGQTAV-VAGWGWQQENRNLGDKADTLQRAVVDVFRNEECESMYRRGNRSRTIARTQLC 204

  Fly   203 AGVNGGGKDACQGDSGGPLV-YNNTLLGIVSWGTGCAREKYPGVYCSVPDVLDWLVETVADKES 265
            ||...||.|||..||||||| .:|.|:||||.|.||||..:||:|..|.:...|:| ||.|:.|
Mosquito   205 AGKGTGGVDACWADSGGPLVTSDNVLIGIVSTGIGCARPGFPGIYTRVSEYASWIV-TVIDRLS 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 87/247 (35%)
Tryp_SPc 36..259 CDD:238113 88/250 (35%)
AgaP_AGAP001395XP_321740.5 Tryp_SPc 11..259 CDD:214473 87/248 (35%)
Tryp_SPc 12..259 CDD:238113 86/247 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.