DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and AgaP_AGAP011793

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_320722.4 Gene:AgaP_AGAP011793 / 1280855 VectorBaseID:AGAP011793 Length:426 Species:Anopheles gambiae


Alignment Length:244 Identity:73/244 - (29%)
Similarity:105/244 - (43%) Gaps:47/244 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 HRCGGTIYRSNQIISAAHCVNTLSGPENLTIVA-------GSSNIWFPTGPQQELEVREIIIHPK 116
            :.|||::...:.|::|||||      :|:||.|       ..:..|....|.|:..|.||..|.:
Mosquito   193 YMCGGSLIHPSVILTAAHCV------QNITITALKVRLGEWDTRSWKEPFPHQDRRVVEIAFHEQ 251

  Fly   117 Y---RTLNNDYDAAILILDGDFEFNDAVQPIELAKERPDHDTPV--TVTGWGTTSEG--GTISDV 174
            :   ..|||   .|:|.||...|..:.|..|.|.......| ||  ..:|||....|  |....:
Mosquito   252 FFAPAALNN---VALLFLDKPVELMETVNTICLPPANYTFD-PVRCVASGWGKDVFGNEGMFQAI 312

  Fly   175 LQEVSVNVVDNSNCKNAYSIMLTSR-------MLCAGVNGGGKDACQGDSGGPLV---------- 222
            |::|.:.::....|:.|..:....|       .|||| ...|:|.|:||.|.|||          
Mosquito   313 LKKVELPLMPRGACQRALRMTRLGRRFKLHESFLCAG-GEKGRDTCKGDGGSPLVCPIPGVANGY 376

  Fly   223 YNNTLLGIVSWGTGCAREKYPGVYCSVPDVLDWLVETVADKESVGKIDF 271
            |.   ..||:||..|..|..||||.:|....:|:.|.:..:...  ||:
Mosquito   377 YQ---ASIVAWGINCGIEGVPGVYVNVALFREWIDEQLRKRNLA--IDY 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 69/226 (31%)
Tryp_SPc 36..259 CDD:238113 70/230 (30%)
AgaP_AGAP011793XP_320722.4 Tryp_SPc 167..410 CDD:238113 70/230 (30%)
Tryp_SPc 167..407 CDD:214473 69/227 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.