DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and AgaP_AGAP011794

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_320721.3 Gene:AgaP_AGAP011794 / 1280854 VectorBaseID:AGAP011794 Length:154 Species:Anopheles gambiae


Alignment Length:137 Identity:41/137 - (29%)
Similarity:61/137 - (44%) Gaps:27/137 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 PV--TVTGWGTTSEG--GTISDVLQEVSVNVVDNSNCKNAY-------SIMLTSRMLCAGVNGGG 209
            ||  ..:|||....|  |.:..::::|.:.:|....|:.|.       ...|....:||| ...|
Mosquito    18 PVRCVASGWGKDVFGNEGMLQVIMKKVELPLVPRGACQRALRTTHLGRQFKLHESFVCAG-GEKG 81

  Fly   210 KDACQGDSGGPLV----------YNNTLLGIVSWGTGCAREKYPGVYCSVPDVLDWLVETVADKE 264
            :|.|:||.|.|||          |.   .|||:||..|.:|..||||.:|....:|:.|.:..:.
Mosquito    82 RDTCKGDGGSPLVCPIPGVANGYYQ---AGIVAWGIDCGKEGIPGVYVNVALFREWIDEQLRKRN 143

  Fly   265 SVGKIDF 271
            ..  ||:
Mosquito   144 LA--IDY 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 37/119 (31%)
Tryp_SPc 36..259 CDD:238113 38/123 (31%)
AgaP_AGAP011794XP_320721.3 Tryp_SPc <2..138 CDD:238113 38/123 (31%)
Tryp_SPc <2..135 CDD:214473 37/120 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.