DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and AgaP_AGAP011908

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_320621.4 Gene:AgaP_AGAP011908 / 1280755 VectorBaseID:AGAP011908 Length:391 Species:Anopheles gambiae


Alignment Length:235 Identity:69/235 - (29%)
Similarity:111/235 - (47%) Gaps:21/235 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RIVGGQDTNITQYPHQISM--RYRGNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSSNIW 97
            :||||....:.:|...:.:  ....|..|.|.|..|..:::||||..|:.....:..:.|..:  
Mosquito   153 KIVGGSVAGVNEYTAMVGLLDPLTVNVFCSGAIISSRYVLTAAHCARTIPSVSRVQALVGDHD-- 215

  Fly    98 FPTG---PQQEL-EVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIELAKERPDHD---T 155
            :.:|   |...: .:.:||.|..|.....:.|.|:|....:.:||..|.||.|......:.   .
Mosquito   216 YRSGLDTPYSAIYNIEQIISHEYYNEQTRNNDIALLKTSTEMDFNRGVGPICLPFTYSTYSFGGL 280

  Fly   156 PVTVTGWGTTSEGGTISDVLQEVSVNVVDNSNCKNAYSIMLTSRMLCAGVNGGGKDACQGDSGGP 220
            .|.:.||||||.||.:|.:|::.::||:.|:||...|   :..:.:|  ....|:|:||.||||.
Mosquito   281 SVDIAGWGTTSFGGPMSTILRKTTLNVLQNANCTAPY---VNDQKIC--TFAVGRDSCQYDSGGA 340

  Fly   221 LVYNNT----LLGIVSWGTGCAREKYPGVYCSVPDVLDWL 256
            |....:    .:||:|:|:.||... |.|...|...|.|:
Mosquito   341 LFLRGSQRMYSIGIISYGSACAAST-PSVATRVTAYLSWI 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 68/232 (29%)
Tryp_SPc 36..259 CDD:238113 69/234 (29%)
AgaP_AGAP011908XP_320621.4 CUB 26..>106 CDD:294042
Tryp_SPc 153..379 CDD:214473 68/233 (29%)
Tryp_SPc 154..382 CDD:238113 69/234 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.