DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and CG43335

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001247121.1 Gene:CG43335 / 12798413 FlyBaseID:FBgn0263040 Length:281 Species:Drosophila melanogaster


Alignment Length:249 Identity:66/249 - (26%)
Similarity:109/249 - (43%) Gaps:44/249 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSSNIWFP 99
            ||:||.|..||.:|....:....::.|.||:..:..:::||||:   ...:|||:..|.|.:...
  Fly    41 RIIGGSDAEITSHPWMAYLYNEFHYFCAGTLITNQFVLTAAHCI---EASKNLTVRLGGSGLTRS 102

  Fly   100 TGPQQELEVRE----IIIHPKYRT----LNNDYDAAILILDGDFEFNDAVQPIELAKERP----- 151
            .|...::...:    :.|..||.|    ||   |.|::.|....:|.|.::||.:..:..     
  Fly   103 DGSMCQITAEDYSVSMAIKHKYFTPSIMLN---DIAMIRLARTVKFYDHIRPICIILDPAVRLLL 164

  Fly   152 DHDTPVTVTGWGTTSEGGTISD------VLQEVSVNVVDNSNCKNAYSIMLTSRMLCAGVNGGGK 210
            :....:..||||       ::|      :|||..:.|::.:.|...|.:.:|...:|||  ....
  Fly   165 EDGMTLMATGWG-------LADKRMHPHLLQEAPITVMNRNVCSKLYDVAITQGQICAG--DKET 220

  Fly   211 DACQGDSGGPL-----VYNN---TLLGIVSWGTGCAREKYPGVYCSVPDVLDWL 256
            :.|.|||||||     .|.:   ...||.|:|....|.  |.:|..:.....|:
  Fly   221 NTCLGDSGGPLGGVVNYYGDLRFVQYGITSFGDIECRS--PSIYTDLSTYSGWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 65/246 (26%)
Tryp_SPc 36..259 CDD:238113 65/248 (26%)
CG43335NP_001247121.1 Tryp_SPc 41..272 CDD:214473 65/247 (26%)
Tryp_SPc 42..275 CDD:238113 65/248 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.