DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and TRY4_ANOGA

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_317173.2 Gene:TRY4_ANOGA / 1277690 VectorBaseID:AGAP008292 Length:275 Species:Anopheles gambiae


Alignment Length:274 Identity:105/274 - (38%)
Similarity:148/274 - (54%) Gaps:26/274 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ILVVFLVLGVGCSLADPIY-RNEEVHIPKL---------DGRIVGGQDTNITQYPHQISMRYRGN 58
            ||:..|:..|.|:.|...: |.....:|:.         :.|||||.:.::.:.|:|:|::....
Mosquito     7 ILLAVLLAVVACAQAHASHQRRVPYPLPRFLPRPHHTVSNHRIVGGFEIDVAETPYQVSLQRSKR 71

  Fly    59 HRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSSNIWFPTGPQQELEVREIIIHPKYRTLNND 123
            |.|||::.....|::||||.:. |.|.:||:..|||.   .......:.|..|:.||.|.....|
Mosquito    72 HICGGSVLSGKWILTAAHCTDG-SQPASLTVRLGSSR---HASGGSVIHVARIVQHPDYDQETID 132

  Fly   124 YDAAILILDGDFEFNDAVQPIELAKERPDHDTPV------TVTGWGTTSEGGTISDVLQEVSVNV 182
            ||.::|.|:....|::.||||.|    |:.|..|      .|:|||:|......:.:|:..:|..
Mosquito   133 YDYSLLELESVLTFSNKVQPIAL----PEQDEAVEDGIMTIVSGWGSTKSAIESNAILRAANVPT 193

  Fly   183 VDNSNCKNAY--SIMLTSRMLCAGVNGGGKDACQGDSGGPLVYNNTLLGIVSWGTGCAREKYPGV 245
            |:...|..||  |..:|.||||||...|||||||||||||||..:.|:|:||||.|||:..||||
Mosquito   194 VNQDECNQAYHKSEGITERMLCAGYQQGGKDACQGDSGGPLVAEDKLIGVVSWGAGCAQPGYPGV 258

  Fly   246 YCSVPDVLDWLVET 259
            |..|..|.||:.||
Mosquito   259 YARVAVVRDWIRET 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 93/227 (41%)
Tryp_SPc 36..259 CDD:238113 94/230 (41%)
TRY4_ANOGAXP_317173.2 Tryp_SPc 48..269 CDD:214473 94/228 (41%)
Tryp_SPc 49..272 CDD:238113 94/230 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.