DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and AgaP_AGAP008403

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_317049.4 Gene:AgaP_AGAP008403 / 1277577 VectorBaseID:AGAP008403 Length:873 Species:Anopheles gambiae


Alignment Length:260 Identity:73/260 - (28%)
Similarity:125/260 - (48%) Gaps:39/260 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 GQDTNITQYPHQISMRYRGNH-----RCGGTIYRSNQIISAAHCV--NTLSGPENLTIVAGSSNI 96
            |:...:.::.|..::.:.|.:     .|||::...|.:::||||.  :..:.|:  .:..|..|:
Mosquito    20 GRPAYLREFAHMAAVGWTGENGKIDWNCGGSLIWENYVLTAAHCTADDNNAAPD--VVRLGDINL 82

  Fly    97 WFPTGPQ--QELEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIELAKERPDHDTP--- 156
            ...:..:  |:|::.|||.||::|..:..:|.|:|.|:.:...:|.|.|..|..   |.:.|   
Mosquito    83 DDDSDDKYAQQLKIVEIIRHPEHRFSSRYHDLALLRLERNVTLHDTVAPGCLWN---DEEIPFPS 144

  Fly   157 VTVTGWGTTSEGGTISDVLQEVSVNVVDNSNCKNAY-------SIMLTSRMLCAGVNGGGKDACQ 214
            :..||||:|  |...:.:|.:||:::|..|.|...|       ...|....||||  ....|.|.
Mosquito   145 MEATGWGST--GFAKTPILLKVSLSLVPKSTCDQQYRKGDRGLRQGLQDYQLCAG--DIKMDTCP 205

  Fly   215 GDSGGPL---VYNNT-----LLGIVSWGTGCAREKYPGVYCSVPDVLDWLVETVADKESV--GKI 269
            |||||||   :..|.     ::.:.|:|:.|. :..||||..|...:.|:...:|.:..:  |||
Mosquito   206 GDSGGPLQMKLLANAKMTPFIIAVTSFGSVCG-QSTPGVYMKVSPYIPWIRSELAKRGELIRGKI 269

  Fly   270  269
            Mosquito   270  269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 68/242 (28%)
Tryp_SPc 36..259 CDD:238113 69/246 (28%)
AgaP_AGAP008403XP_317049.4 Tryp_SPc 20..256 CDD:238113 69/245 (28%)
Tryp_SPc 20..254 CDD:214473 68/243 (28%)
Tryp_SPc 324..552 CDD:304450
CLIP 577..617 CDD:295450
Tryp_SPc 656..872 CDD:304450
Tryp_SPc 656..869 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.