DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and AgaP_AGAP006674

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_316711.4 Gene:AgaP_AGAP006674 / 1277264 VectorBaseID:AGAP006674 Length:306 Species:Anopheles gambiae


Alignment Length:252 Identity:77/252 - (30%)
Similarity:117/252 - (46%) Gaps:44/252 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RIVGGQDTNITQYPHQISMRYR---GNHRCGGTIYRSNQIISAAHCV-----------NTLSGPE 85
            |||.||.....|:|:|:::...   |...||.||..:|.:::|||||           ..:.|..
Mosquito    59 RIVNGQQATPGQFPYQVALLSNFGTGTGLCGATIITNNFLLTAAHCVVGGNGQVAIGGTAILGAH 123

  Fly    86 NLTIVAGSSNIWFPTGPQQELEVRE--IIIHPKYR--TLNNDYDAAILILDGDFEFNDAVQPIEL 146
            :.|:|.       ||  ||.:...:  |.:||.|.  |:.|  |.|.:.|:....||..||||:|
Mosquito   124 DRTVVE-------PT--QQRIAFAQSGIFVHPSYNPSTIRN--DIATVRLNTPATFNARVQPIDL 177

  Fly   147 AKERPDHDT----PVTVTGWGTTSEGGT-ISDVLQEVSVNVVDNSNCKNAYS-IMLTSRMLCAGV 205
             ..|.|..|    ..|.:|:|.||:..| .|.|:......::.|:.|.:.:| .::.::.:|...
Mosquito   178 -PARSDARTFAGVEGTASGFGRTSDASTATSPVVMFTRNPILSNAQCNSFWSTAVVQAQNVCLDA 241

  Fly   206 NGGGKDACQGDSGGPLVY----NNTLLGIVSW--GTGCAREKYPGVYCSVPDVLDWL 256
            . ||:..|.|||||||..    .:..:||.|:  ..||| ...|.|:..:....||:
Mosquito   242 T-GGRSPCNGDSGGPLAVQDGGRSLEVGIASFVSAAGCA-SGAPSVWVRISFFRDWI 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 75/249 (30%)
Tryp_SPc 36..259 CDD:238113 76/251 (30%)
AgaP_AGAP006674XP_316711.4 Tryp_SPc 59..296 CDD:214473 76/250 (30%)
Tryp_SPc 60..299 CDD:238113 76/251 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.