DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and AgaP_AGAP005707

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_315716.4 Gene:AgaP_AGAP005707 / 1276376 VectorBaseID:AGAP005707 Length:299 Species:Anopheles gambiae


Alignment Length:241 Identity:67/241 - (27%)
Similarity:110/241 - (45%) Gaps:30/241 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RIVGGQDTNITQYPHQISMRYRGNHR---CGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSSNI 96
            ||..||....||:|..:.:...|:..   |.|.:.....:::||.|:   ||...|||:.|:|::
Mosquito    61 RISDGQIATATQFPWAVGVLISGSSSHSFCSGVLISPRFVLTAAVCI---SGSNTLTILLGASDM 122

  Fly    97 WFPTGPQQELEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIELAK----ERPDHDTPV 157
               |..::.:.|..|:.||.|.:..|..|.|||.|.......:.::||:|.:    ....::...
Mosquito   123 ---TRVEEFIGVSNILSHPNYSSFFNRDDIAILTLSSPAPIRNTIRPIDLPRWSDVGNNFNNWAA 184

  Fly   158 TVTGWGTTS--EGGTISDVLQEVSVNVVDNSN--CKNAYSIMLTSRMLCAGVNGGGKDACQGDSG 218
            |..|||.|.  |...|.......:|:.| |||  |..:::.:..:. :|...:.||  .|.||.|
Mosquito   185 TTAGWGNTGRRENEPIPIPNLHFAVDSV-NSNFVCGLSHTFIRDTH-ICTSTDNGG--PCNGDEG 245

  Fly   219 GPLVYNNT----LLGIVSWG----TGCAREKYPGVYCSVPDVLDWL 256
            ||:....:    |:||.|:.    .||.|.: ..|:..:.:.|.|:
Mosquito   246 GPVTVTESGRTFLVGIHSFHYSGLFGCDRGR-SAVHTRITEYLGWI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 66/238 (28%)
Tryp_SPc 36..259 CDD:238113 66/240 (28%)
AgaP_AGAP005707XP_315716.4 Tryp_SPc 61..290 CDD:214473 66/239 (28%)
Tryp_SPc 62..293 CDD:238113 66/240 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.