DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and AgaP_AGAP004858

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_314333.4 Gene:AgaP_AGAP004858 / 1275108 VectorBaseID:AGAP004858 Length:435 Species:Anopheles gambiae


Alignment Length:223 Identity:64/223 - (28%)
Similarity:98/223 - (43%) Gaps:38/223 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 CGGTIYRSNQIISAAHCVNTLSG--PE--NLTIVAGSSNIWFPTGP-QQELEVREIIIHPKYRTL 120
            |||::.....:::||||.....|  |:  .|.::..::.::.|... .||..:.....||::...
Mosquito    17 CGGSLITPRHVLTAAHCALNDDGVAPQVVRLGVIDITAGLYDPQNQFAQEYGISSFRRHPEHEFR 81

  Fly   121 NNDYDAAILILDGDFEFNDAVQP--------IELAKERPDHDTPVTVTGWGTTSEGGTISDVLQE 177
            ...:|..::.||......|||.|        :.|.:        :...|:|.||.||..:.:|.:
Mosquito    82 AEYHDIGLVTLDRPVTLTDAVVPACLWTGAQVPLRR--------LEAVGFGQTSFGGERTPILLK 138

  Fly   178 VSVNVVDNSNCKNAYSIM------LTSRMLCAGVNGGGKDACQGDSGGP----LVYNNTLL---- 228
            |.::.||||.|...|...      |..:.:||  :....|.|.||||||    |:.||.|:    
Mosquito   139 VQLSPVDNSACGRFYPPSRRRRQGLIDQQMCA--SDERMDTCHGDSGGPLQLKLMANNRLIPFVV 201

  Fly   229 GIVSWGTGCAREKYPGVYCSVPDVLDWL 256
            ||.|:|..|.... |.||..|...:|||
Mosquito   202 GITSFGRFCGTAT-PAVYTRVSSYVDWL 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 61/220 (28%)
Tryp_SPc 36..259 CDD:238113 64/223 (29%)
AgaP_AGAP004858XP_314333.4 Tryp_SPc 1..229 CDD:238113 64/223 (29%)
Tryp_SPc 1..227 CDD:214473 61/220 (28%)
Tryp_SPc 295..>384 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.