DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and AgaP_AGAP005195

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_314094.4 Gene:AgaP_AGAP005195 / 1274901 VectorBaseID:AGAP005195 Length:250 Species:Anopheles gambiae


Alignment Length:258 Identity:69/258 - (26%)
Similarity:113/258 - (43%) Gaps:21/258 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LVVFLVLGVGCSLADPIYRNEEVHIPKLDGRIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSN 69
            ||:.:|..:..|..:|:            ..|:||.:....:.|:.:|:.. .:..|||:|....
Mosquito     9 LVLLVVHSLEASPVEPL------------APIIGGSNVEDKKVPYLVSITV-NSFVCGGSIIADR 60

  Fly    70 QIISAAHCVNTLSGPENLTIVAGSSNIWFPTGPQQELEVREIIIHPKY-RTLNNDYDAAILILDG 133
            .|::|||||.. :..:|..:...::|.   |.......:...|.|.|| |....| |..:|.|..
Mosquito    61 WILTAAHCVKR-NMVKNAAVRVETNNF---TASGTLYRIDRAIAHEKYFRGAFRD-DVGLLRLRS 120

  Fly   134 DFEFNDAVQPIELAKERPDHDTPVTVTGWGTTSEGGTISDVLQEVSVNVVDNSNCKNAYSIMLTS 198
            ..:|.:.|:.|||..:...::..:|:.|.|..|:....:.:.|.:....:....|:......:..
Mosquito   121 PLKFGERVKKIELLSQIVPYNATLTLVGRGYISKDNKTTKITQMIKAKNIALKLCRKMQPDFIYP 185

  Fly   199 RMLCAGVNGGGKDACQGDSGGPLVYNNTLLGIVSWGTGCAREKYPGVYCSVPDVLDWLVETVA 261
            ..||..|. .||..|.||||||:|:....:|||||..||. ..|..|:..:...|.|:..|:|
Mosquito   186 GHLCTFVK-KGKGTCSGDSGGPVVWYGRQVGIVSWSKGCG-AGYFDVHSRISYFLPWIKATIA 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 61/220 (28%)
Tryp_SPc 36..259 CDD:238113 62/223 (28%)
AgaP_AGAP005195XP_314094.4 Tryp_SPc 28..244 CDD:238113 62/223 (28%)
Tryp_SPc 28..241 CDD:214473 61/220 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.