DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and AgaP_AGAP010661

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_311381.4 Gene:AgaP_AGAP010661 / 1272469 VectorBaseID:AGAP010661 Length:175 Species:Anopheles gambiae


Alignment Length:157 Identity:54/157 - (34%)
Similarity:79/157 - (50%) Gaps:6/157 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 EVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIELAKERPDHDTPVTVTGWGTTS-EGGT 170
            :..:|:|||.|....:||||||:.:...|:..|.:.||.|.......||.....|||..: :..|
Mosquito    18 QASKIVIHPYYNPETHDYDAAIVEIKTSFQGYDNIAPIALQDAEVPSDTTCYAAGWGLNNYDRRT 82

  Fly   171 ISDVLQEVSVNVVDNSNCKNAYSIMLTSRMLCAGVNGGGKDACQGDSGGPLVYNNTLLGIVSW-G 234
            ..|.||..::.|:....|..|:....|.:::||..|..| |.|:||||||.|.|..|.|..|: |
Mosquito    83 TPDNLQYATLQVITQQQCSAAWGSYATPQVICAQQNNNG-DVCKGDSGGPFVCNGKLTGATSYGG 146

  Fly   235 TGCAREKYPGVYCSV--PDVLDWLVET 259
            .|| |.:.|..:..|  |.:.:::..|
Mosquito   147 IGC-RGRLPSAFAKVTAPAIREFIRNT 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 53/151 (35%)
Tryp_SPc 36..259 CDD:238113 53/155 (34%)
AgaP_AGAP010661XP_311381.4 Tryp_SPc <1..172 CDD:238113 53/155 (34%)
Tryp_SPc <1..162 CDD:214473 52/145 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.