DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and Ctrl

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_446461.1 Gene:Ctrl / 117184 RGDID:621501 Length:264 Species:Rattus norvegicus


Alignment Length:242 Identity:86/242 - (35%)
Similarity:123/242 - (50%) Gaps:27/242 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RIVGGQDTNITQYPHQISMR-YRGNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAG----SS 94
            |||.|::.....:|.|:|:: ..|.|.|||::...|.:::||||..|   |....::.|    ||
  Rat    33 RIVNGENAVPGSWPWQVSLQDNTGFHFCGGSLIAPNWVVTAAHCKVT---PGRHFVILGEYDRSS 94

  Fly    95 NIWFPTGPQQELEVREIIIHPKY--RTLNNDYDAAILILDGDFEFNDAVQPIELAKER---PDHD 154
            |    ..|.|.|.:.:.|.||.:  .|:||  |..:|.|.....:...|.|:.||...   |...
  Rat    95 N----AEPIQVLSISKAITHPSWNPNTMNN--DLTLLKLASPARYTAQVSPVCLASSNEALPAGL 153

  Fly   155 TPVTVTGWGTTSEGGTISDV-LQEVSVNVVDNSNCKNAYSIMLTSRMLCAGVNGGGKDACQGDSG 218
            |.|| ||||..|..|.::.. ||:|.:.:|..:.|:..:...:|..|:|||  |.|..:||||||
  Rat   154 TCVT-TGWGRISGVGNVTPARLQQVVLPLVTVNQCRQYWGSRITDSMICAG--GAGASSCQGDSG 215

  Fly   219 GPLV--YNNT--LLGIVSWGTGCAREKYPGVYCSVPDVLDWLVETVA 261
            ||||  ..||  |:|||||||.....:.|.:|..|.....|:.:.:|
  Rat   216 GPLVCQKGNTWVLIGIVSWGTENCNVQAPAMYTRVSKFNTWINQVIA 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 84/234 (36%)
Tryp_SPc 36..259 CDD:238113 84/237 (35%)
CtrlNP_446461.1 Tryp_SPc 33..257 CDD:214473 84/235 (36%)
Tryp_SPc 34..260 CDD:238113 84/237 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.