DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and LOC116407662

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_031749278.1 Gene:LOC116407662 / 116407662 -ID:- Length:329 Species:Xenopus tropicalis


Alignment Length:288 Identity:97/288 - (33%)
Similarity:144/288 - (50%) Gaps:46/288 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ILVVFLVLGVGCSLADPIY--RNEEVHIPKLDG-------RIVGGQDTNITQYPHQISMRYRGNH 59
            ::...|:|.:|      ||  ..||..:.|:.|       |||||||:...|:|.|..:.:....
 Frog     6 LIRALLLLNLG------IYGFAKEEAKLSKVCGKPVVDRSRIVGGQDSKKGQHPWQAIVWHPSKV 64

  Fly    60 RCGGTIYRSNQIISAAHCVNTLSGPENLT---IVAGSSNIWFPTGPQQE---LEVREIIIHPKYR 118
            |||||:..|..:::||.|:.:    ||.|   ::.|:.||   ||..:|   ::|..||:|.:|.
 Frog    65 RCGGTLISSRYVLTAAQCLES----ENDTSVIVILGAYNI---TGNHKEEVSVKVNRIILHHRYN 122

  Fly   119 TLNNDYDAAILILDGDFEFNDAVQPIEL----AKERPDHDTPVTVTGWGTTSEGGTISD--VLQE 177
            ..:..||.|:|.|.....|.|.:.|..|    .:..|.|.  ..|||||.|....|...  :|||
 Frog   123 DSDFPYDIALLELSNSVPFTDFILPACLPPFPTEFLPGHS--CLVTGWGDTDYDSTKPKPVILQE 185

  Fly   178 VSVNVVDNSNCKNAYSI-----MLTSRMLCAGVNGGGKDACQGDSGGPLVYNN----TLLGIVSW 233
            ..|.::|..:|::.|.:     ::|..|.||....|.:..|:||.|||||.:.    .|:|:||:
 Frog   186 AGVRLIDLQHCRDLYKLVTNDSIITENMTCAMDIHGKRSFCRGDGGGPLVCHAGEQWFLVGVVSF 250

  Fly   234 GTGCAREKYPGVYCSVPDVLDWLVETVA 261
            |.||. ...||||.|||..:||:.|.::
 Frog   251 GYGCG-HGIPGVYTSVPAYVDWIKEHIS 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 85/240 (35%)
Tryp_SPc 36..259 CDD:238113 86/243 (35%)
LOC116407662XP_031749278.1 Tryp_SPc 41..275 CDD:238113 86/243 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.