DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and Prss28

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_444489.2 Gene:Prss28 / 114661 MGIID:2149951 Length:274 Species:Mus musculus


Alignment Length:272 Identity:83/272 - (30%)
Similarity:129/272 - (47%) Gaps:31/272 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LVLGVGCSLADPIYRNEEVHIPKLDGRIVGGQDTNITQYPHQISMR---YRGN---HRCGGTIYR 67
            |:|.:.|..:.....:..:...|..| |||||.|...::|.|:|:|   |..|   |.|||:|..
Mouse     5 LLLALSCLESTVFMASVSISRSKPVG-IVGGQCTPPGKWPWQVSLRMYSYEVNSWVHICGGSIIH 68

  Fly    68 SNQIISAAHCVNTL-SGPENLTIVAGSSNIWFPTGPQQELEVREIIIHPKYRTLNNDYDAAILIL 131
            ...|::||||:.:. :.|....:..|...::   ..|:.|.:..|||||.|..::..:|.|::.|
Mouse    69 PQWILTAAHCIQSQDADPAVYRVQVGEVYLY---KEQELLNISRIIIHPDYNDVSKRFDLALMQL 130

  Fly   132 DGDFEFNDAVQPIELAKERPDHDT--PVTVTGWGTTSEGGTISD--VLQEVSVNVVDNSNCKNAY 192
            ......:..|.|:.|.|:....|:  ...:.|||...:...:..  .|.||.:.:.||.:||.||
Mouse   131 TALLVTSTNVSPVSLPKDSSTFDSTDQCWLVGWGNLLQRVPLQPPYQLHEVKIPIQDNKSCKRAY 195

  Fly   193 ---------SIMLTSRMLCAGVNGGGKDACQGDSGGPLV---YNNTL-LGIVSWGTGCAREKYPG 244
                     ::.:...|||||.:|.|  .|.||||||||   .|..: :|:||.|..|: ...|.
Mouse   196 RKKSSDEHKAVAIFDDMLCAGTSGRG--PCFGDSGGPLVCWKSNKWIQVGVVSKGIDCS-NNLPS 257

  Fly   245 VYCSVPDVLDWL 256
            ::..|...|.|:
Mouse   258 IFSRVQSSLAWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 77/243 (32%)
Tryp_SPc 36..259 CDD:238113 78/245 (32%)
Prss28NP_444489.2 Tryp_SPc 31..272 CDD:238113 78/245 (32%)
Tryp_SPc 31..269 CDD:214473 77/243 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.