DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and Prss1

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_444473.1 Gene:Prss1 / 114228 MGIID:98839 Length:246 Species:Mus musculus


Alignment Length:264 Identity:97/264 - (36%)
Similarity:140/264 - (53%) Gaps:23/264 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRILVVFLVLGVGCSLADPIYRNEEVHIPKLDGRIVGGQDTNITQYPHQISMRYRGNHRCGGTI 65
            ||.:|  ||.| ||.::|.|:         ..|.:||||........|:|:|:. .|.|.|||::
Mouse     1 MSALL--FLAL-VGAAVAFPV---------DDDDKIVGGYTCRENSVPYQVSLN-SGYHFCGGSL 52

  Fly    66 YRSNQIISAAHCVNTLSGPENLTIVAGSSNIWFPTGPQQELEVREIIIHPKY--RTLNNDYDAAI 128
            .....::|||||..|     .:.:..|..||....|.:|.::..:||.||.:  :||||  |..:
Mouse    53 INDQWVVSAAHCYKT-----RIQVRLGEHNINVLEGNEQFIDAAKIIKHPNFNRKTLNN--DIML 110

  Fly   129 LILDGDFEFNDAVQPIELAKERPDHDTPVTVTGWGTT-SEGGTISDVLQEVSVNVVDNSNCKNAY 192
            :.|......|..|..:.|........|...::|||.| |.|.:..|:||.:...::..::|:.:|
Mouse   111 IKLSSPVTLNARVATVALPSSCAPAGTQCLISGWGNTLSFGVSEPDLLQCLDAPLLPQADCEASY 175

  Fly   193 SIMLTSRMLCAGVNGGGKDACQGDSGGPLVYNNTLLGIVSWGTGCAREKYPGVYCSVPDVLDWLV 257
            ...:|..|:|||...||||:||||||||:|.|..|.||||||.|||....||||..|.:.:||:.
Mouse   176 PGKITGNMVCAGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQ 240

  Fly   258 ETVA 261
            :|:|
Mouse   241 DTIA 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 82/222 (37%)
Tryp_SPc 36..259 CDD:238113 84/225 (37%)
Prss1NP_444473.1 Tryp_SPc 23..239 CDD:214473 83/223 (37%)
Tryp_SPc 24..242 CDD:238113 84/225 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.