DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and LOC108647852

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_017950296.2 Gene:LOC108647852 / 108647852 -ID:- Length:416 Species:Xenopus tropicalis


Alignment Length:243 Identity:72/243 - (29%)
Similarity:122/243 - (50%) Gaps:26/243 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RIVGGQDTNITQYPHQISMR--YRGNH--RCGGTIYRSNQIISAAHCVNTLSGPENLT-IVAGSS 94
            |::.|.......:|...|::  |:..:  .|||.:..:..:::||||::.|....:|. ||.|:.
 Frog    43 RVIEGNTPEPGSWPWMASIQLLYKDGYGSACGGVLLSNRWVVTAAHCLSDLKRYRHLARIVLGAR 107

  Fly    95 NIWFPTGPQQELE-VREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIELAKERPDHDTPV- 157
            :: ...||:.::. :::.|.|..:....:..|.|::.|:...:|:|.:||..|    |...:.| 
 Frog   108 DL-TQLGPETQIRTIKQWIQHEDFDHKTHKNDIALIRLNYPVKFSDYIQPACL----PPKSSNVY 167

  Fly   158 -----TVTGWGTTSE-GGTISDVLQEVSVNVVDNSNCKNA--YSIMLTSRMLCAGVNGGGKDACQ 214
                 .:.|||..:| ..|::.:|||.:|.::|...|.::  |:..:....||||...||.|.|.
 Frog   168 KMDDCHIAGWGLLNEKPRTVTTMLQEATVELIDRKRCNSSDWYNGGIHDDNLCAGYEQGGPDVCM 232

  Fly   215 GDSGGPLVYNNT------LLGIVSWGTGCAREKYPGVYCSVPDVLDWL 256
            |||||||:....      ::||||||..|.:....|||.||.|...|:
 Frog   233 GDSGGPLMCKRKKAGIYYVVGIVSWGGLCGQPHSNGVYTSVQDFEQWI 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 71/240 (30%)
Tryp_SPc 36..259 CDD:238113 71/242 (29%)
LOC108647852XP_017950296.2 Tryp_SPc 44..280 CDD:238113 70/240 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.