DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and si:dkey-32n7.7

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_021335883.1 Gene:si:dkey-32n7.7 / 108191692 ZFINID:ZDB-GENE-121214-179 Length:609 Species:Danio rerio


Alignment Length:234 Identity:85/234 - (36%)
Similarity:129/234 - (55%) Gaps:19/234 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCVNTLSGPEN---LTIVAG--SSNI 96
            ||||:::...:|.|.|:.:.....|||::.....::|||||.|   |..|   ||::.|  :.|.
Zfish   309 VGGQNSSAVHWPWQASLYWYSGQTCGGSLINKEWVLSAAHCFN---GQRNGFYLTVILGPKTQNK 370

  Fly    97 WFPTGPQQELEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIELAKERP--DHDTPVTV 159
            :.|:  :....|:.:|.||.|....||.|.|::.|.....|.|:::|:.||.|..  :.||...:
Zfish   371 YDPS--RISRSVKAVIKHPYYNPNTNDNDIALVRLSFPITFTDSIRPVCLAAEGSVFNSDTESWI 433

  Fly   160 TGWGTTSEGGTISD--VLQEVSVNVVDNSNCKNAYSI-MLTSRMLCAGVNGGGKDACQGDSGGPL 221
            |.|...|:|..:..  :.|||.|.|:.|..|...|.: .:|..|:|||:...|||.||||||||:
Zfish   434 TTWRNISDGVPLPSPKIFQEVEVPVIGNRQCNCLYGVGSITDNMICAGLLKEGKDLCQGDSGGPM 498

  Fly   222 VYNNTLL----GIVSWGTGCAREKYPGVYCSVPDVLDWL 256
            |.|.:.:    ||||:|:|||:.::||||..|....:|:
Zfish   499 VSNQSSVWVQSGIVSFGSGCAQSEFPGVYTRVSRYQEWI 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 84/231 (36%)
Tryp_SPc 36..259 CDD:238113 85/234 (36%)
si:dkey-32n7.7XP_021335883.1 NIDO 4..63 CDD:310601
NIDO 141..272 CDD:322035
Tryp_SPc 309..537 CDD:238113 84/232 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.