DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and MASP2

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_006601.2 Gene:MASP2 / 10747 HGNCID:6902 Length:686 Species:Homo sapiens


Alignment Length:248 Identity:77/248 - (31%)
Similarity:115/248 - (46%) Gaps:24/248 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GRIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCV-NTLSGPENLTIVAGSSNIW 97
            |||.|||......:|.|:.:  .|.....|.:...|.:::|||.| ........|.|..|:....
Human   443 GRIYGGQKAKPGDFPWQVLI--LGGTTAAGALLYDNWVLTAAHAVYEQKHDASALDIRMGTLKRL 505

  Fly    98 FPTGPQQELEVREIIIHPKY-RTLNNDYDAAILILDGDFEFNDAVQPIELAKERPDH----DTPV 157
            .|...|...|.  :.||..| .....|.|.|::.|:.....|..:.||.|.::..:.    |...
Human   506 SPHYTQAWSEA--VFIHEGYTHDAGFDNDIALIKLNNKVVINSNITPICLPRKEAESFMRTDDIG 568

  Fly   158 TVTGWGTTSEGGTISDVLQEVSVNVVDNSNCKNAYSI------MLTSRMLCAGVNGGGKDACQGD 216
            |.:|||.| :.|.::..|..|.:.:||:..|..||..      .:|:.|||||:..||||:|:||
Human   569 TASGWGLT-QRGFLARNLMYVDIPIVDHQKCTAAYEKPPYPRGSVTANMLCAGLESGGKDSCRGD 632

  Fly   217 SGGPLVYNNT------LLGIVSWGT-GCAREKYPGVYCSVPDVLDWLVETVAD 262
            |||.||:.::      :.||||||: .|......|||..|.:.:.|:...::|
Human   633 SGGALVFLDSETERWFVGGIVSWGSMNCGEAGQYGVYTKVINYIPWIENIISD 685

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 74/238 (31%)
Tryp_SPc 36..259 CDD:238113 74/241 (31%)
MASP2NP_006601.2 CUB 28..134 CDD:214483
EGF_CA 138..176 CDD:214542
CUB 184..293 CDD:278839
CCP 300..361 CDD:214478
Sushi 366..430 CDD:278512
Tryp_SPc 444..679 CDD:214473 74/239 (31%)
Tryp_SPc 445..682 CDD:238113 74/241 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.