DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and Try5

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_008761147.1 Gene:Try5 / 103690254 RGDID:1560283 Length:246 Species:Rattus norvegicus


Alignment Length:250 Identity:88/250 - (35%)
Similarity:129/250 - (51%) Gaps:16/250 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VGCSLADPIYRNEEVHIPKLDGRIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHC 77
            ||.::|.||         ..|.:||||........|:|:|:. .|.|.|||::.....::|||||
  Rat    10 VGAAVAFPI---------DDDDKIVGGYTCQENSVPYQVSLN-SGYHFCGGSLINDQWVVSAAHC 64

  Fly    78 VNTLSGPENLTIVAGSSNIWFPTGPQQELEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQ 142
            ..:     .:.:..|..||....|.:|.:...:||.||.:...|.:.|..::.|......|..|.
  Rat    65 YKS-----RIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFNARNLNNDIMLIKLSVPVTLNSRVA 124

  Fly   143 PIELAKERPDHDTPVTVTGWGTT-SEGGTISDVLQEVSVNVVDNSNCKNAYSIMLTSRMLCAGVN 206
            .:.|........|...::|||.| |.|....|:||.:...|:..::|:.:|...:|:.|:|.|..
  Rat   125 TVALPSSCAPAGTQCLISGWGNTLSLGVNNPDLLQCLDAPVLPQADCEASYPGKITNNMICVGFL 189

  Fly   207 GGGKDACQGDSGGPLVYNNTLLGIVSWGTGCAREKYPGVYCSVPDVLDWLVETVA 261
            .||||:||||||||:|.|..|.||||||.|||.:..||||..|.:.:||:.:|:|
  Rat   190 EGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALKDNPGVYTKVCNYVDWIQDTIA 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 78/220 (35%)
Tryp_SPc 36..259 CDD:238113 80/223 (36%)
Try5XP_008761147.1 Tryp_SPc 23..239 CDD:214473 79/221 (36%)
Tryp_SPc 24..242 CDD:238113 80/223 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.