DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and LOC102554637

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_017448472.2 Gene:LOC102554637 / 102554637 RGDID:7618053 Length:246 Species:Rattus norvegicus


Alignment Length:264 Identity:94/264 - (35%)
Similarity:139/264 - (52%) Gaps:23/264 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSRILVVFLVLGVGCSLADPIYRNEEVHIPKLDGRIVGGQDTNITQYPHQISMRYRGNHRCGGTI 65
            |..:||:.|   ||.::|.|:         ..|.:||||........|:|:|:. .|.|.|||::
  Rat     1 MRALLVLVL---VGAAVAFPV---------DDDDKIVGGYTCQEHSVPYQVSLN-SGYHYCGGSL 52

  Fly    66 YRSNQIISAAHCVNTLSGPENLTIVAGSSNIWFPTGPQQELEVREIIIHPKY--RTLNNDYDAAI 128
            .....::|||||..:     .:.:..|..||....|.:|.:...:||.||.:  :||||  |..:
  Rat    53 INDQWVVSAAHCYKS-----RIQVRLGEHNINVLEGDEQFVNAAKIIKHPNFDRKTLNN--DIML 110

  Fly   129 LILDGDFEFNDAVQPIELAKERPDHDTPVTVTGWGTT-SEGGTISDVLQEVSVNVVDNSNCKNAY 192
            :.|....:.|..|..:.|........|...::|||.| |.|....|:||.:...::..::|:.:|
  Rat   111 IKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSFGVNDPDLLQCLDAPLLPQADCEASY 175

  Fly   193 SIMLTSRMLCAGVNGGGKDACQGDSGGPLVYNNTLLGIVSWGTGCAREKYPGVYCSVPDVLDWLV 257
            ...:|:.|:|||...||||:||||||||:|.|..|.||||||.|||....||||..|.:.:||:.
  Rat   176 PGKITNNMVCAGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQ 240

  Fly   258 ETVA 261
            :|:|
  Rat   241 DTIA 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 81/222 (36%)
Tryp_SPc 36..259 CDD:238113 83/225 (37%)
LOC102554637XP_017448472.2 Tryp_SPc 24..242 CDD:238113 83/225 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.