DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and gprin3

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_017951795.1 Gene:gprin3 / 101733019 XenbaseID:XB-GENE-6468967 Length:725 Species:Xenopus tropicalis


Alignment Length:162 Identity:37/162 - (22%)
Similarity:63/162 - (38%) Gaps:34/162 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 PHQISMRYRGNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSSNIWFPTGPQQELEV---- 108
            |..:.|....:|      :|:.:|.:.:. ::.|||.||:.:    .||.........|.:    
 Frog   433 PRTMDMYSEPSH------FRAPEINNKSR-LHHLSGVENIQL----HNIRLDNDQTDTLSIPGDD 486

  Fly   109 ---REIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIELAKERPDHDTPVTVTGWGTTSEGGT 170
               |:    |.:..:.|:..:...|:..|.:     :|.:..|..|.| ..|.|...|.|  ||.
 Frog   487 STDRK----PFHFKITNEQGSTQAIITTDIK-----KPKKEDKPTPLH-VEVEVNTIGAT--GGQ 539

  Fly   171 ISDVLQEVSVNVVDNSN---CKNAYSIMLTSR 199
            ..::| ||.|....:.|   .|.:.|..|.:|
 Frog   540 ADEIL-EVLVRKDQDDNGLAGKRSSSFSLQTR 570

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 37/162 (23%)
Tryp_SPc 36..259 CDD:238113 37/162 (23%)
gprin3XP_017951795.1 GRIN_C 600..720 CDD:373668
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.