DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and tmprss2.15

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_031752206.1 Gene:tmprss2.15 / 101732233 XenbaseID:XB-GENE-22065943 Length:504 Species:Xenopus tropicalis


Alignment Length:262 Identity:92/262 - (35%)
Similarity:134/262 - (51%) Gaps:37/262 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VGCSLADPIYRNEEVHIPKLDGRIVGGQDTNITQYPHQIS-MRYRGN--HRCGGTIYRSNQIISA 74
            :.|.|:           .|:|.|||||...::..:|.|:. ::..|.  :.|||:|...:.|::|
 Frog   253 ISCGLS-----------TKVDSRIVGGTPASVGDWPWQVELLKLVGTSIYLCGGSIITPHWIVTA 306

  Fly    75 AHCV-NTLSGPENLTIVAGSSNI--WFPTGPQQELEVREIIIHPKYRTLNNDYDAAILILDGDFE 136
            |||| .:.|.|....:.|||..|  ::..|    ..|...::||.|.:....||.|:|.|.....
 Frog   307 AHCVYGSTSTPSAFKVFAGSLTIQSYYSAG----YTVERALVHPSYSSYTQIYDVALLKLTAALV 367

  Fly   137 FNDAVQPIELAKERPD------HDTPVTVTGWGTTSEGGTISDVLQEVSVNVVDNSNCKNA--YS 193
            |...::|:.|    |:      ...|..::|||||:|||:||..|...||.::.::.|..|  |.
 Frog   368 FTTNLRPVCL----PNVGMPWAEGQPCWISGWGTTAEGGSISKNLMAASVPIISSTTCNQAAVYG 428

  Fly   194 IMLTSRMLCAGVNGGGKDACQGDSGGPLVYNNT----LLGIVSWGTGCAREKYPGVYCSVPDVLD 254
            ..::|.|:|||...||.|.||||||||||....    |:|..|||.||||...||||.:|...::
 Frog   429 GAISSTMMCAGYLSGGTDTCQGDSGGPLVTKTNSLWWLVGDTSWGYGCARAYKPGVYGNVTVFIE 493

  Fly   255 WL 256
            |:
 Frog   494 WI 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 87/237 (37%)
Tryp_SPc 36..259 CDD:238113 87/239 (36%)
tmprss2.15XP_031752206.1 LDLa 93..121 CDD:238060
SRCR_2 164..259 CDD:406055 2/16 (13%)
Tryp_SPc 265..498 CDD:238113 87/239 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.