DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and LOC101732036

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_031749232.1 Gene:LOC101732036 / 101732036 -ID:- Length:308 Species:Xenopus tropicalis


Alignment Length:245 Identity:88/245 - (35%)
Similarity:129/245 - (52%) Gaps:27/245 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LDGRIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSSNI 96
            :..||||||||...|.|.|:.:.:.|...||||:..|:.:::.||||..::. .::.::.|:..|
 Frog    39 VSSRIVGGQDTKKGQNPWQVVVWHSGIKNCGGTLISSSFVLTVAHCVERVNA-SSVIVILGAYKI 102

  Fly    97 WFPTGPQQE---LEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIEL----AKERPDHD 154
               ||..:|   :.|:.||.|..|......||.|:|.|..:..|.|.:.|..|    .:.||.|.
 Frog   103 ---TGNLKEEVSVPVKRIIKHHLYNEAKFPYDIALLELSRNVPFTDFILPACLPAPSVEFRPGHS 164

  Fly   155 TPVTVTGWGTTSEGGT--ISDVLQEVSVNVVDNSNCKNAYS-------IMLTSRMLCAGVNGGGK 210
              ..|||||.|....|  ..|:||||.|.::...:|::.|.       |.:|..::||.....|:
 Frog   165 --CIVTGWGDTEYNSTKPRPDILQEVEVRLITLEDCRDLYKSALKDKYIGITDDIICAMNIHKGR 227

  Fly   211 DACQGDSGGPLV-YNNT---LLGIVSWGTGCAREKYPGVYCSVPDVLDWL 256
            |:||||.||||| |.|.   |:|:||:|.||. ...|.:|.|||..::|:
 Frog   228 DSCQGDGGGPLVCYENDRWYLIGLVSYGIGCG-IGIPKLYSSVPAHMEWI 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 87/239 (36%)
Tryp_SPc 36..259 CDD:238113 87/241 (36%)
LOC101732036XP_031749232.1 Tryp_SPc 43..279 CDD:238113 87/241 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.