DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and prss56

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_017949880.1 Gene:prss56 / 101731690 XenbaseID:XB-GENE-6051085 Length:665 Species:Xenopus tropicalis


Alignment Length:240 Identity:88/240 - (36%)
Similarity:121/240 - (50%) Gaps:19/240 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PKLDGRIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCVNTLSGPEN---LTIVA 91
            ||  ||||||..|:...:|..:::|:.|...|||.:.....|::||||   .:|..|   .|:|.
 Frog    71 PK--GRIVGGSITSPGSWPWLVNIRFNGELMCGGVLLDDMWILTAAHC---FTGSVNEVLWTVVV 130

  Fly    92 GSSNIWFPTGPQQELEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIELAKERPDHDTP 156
            |..::......::..:|..|:.|||:.....|.|.|:|.|......:.:.:|:.|... |...||
 Frog   131 GQYDLTKNAQGEKTFQVNRIVTHPKFNQKTFDNDLALLELTSSVTASQSARPVCLPPV-PRDPTP 194

  Fly   157 VT---VTGWGTTSEGGTISDVLQEVSVNVVDNSNCKNAY-SIMLTSRMLCAGVNGGGKDACQGDS 217
            .|   :.|||:..|.|.:|||:.|..|.|:....|::.. ..||||.|.|||...||.|:|||||
 Frog   195 GTNCYIAGWGSLYEDGPLSDVIMEARVPVLSQEACRSTLGKNMLTSTMFCAGYLNGGIDSCQGDS 259

  Fly   218 GGPLVYNN------TLLGIVSWGTGCAREKYPGVYCSVPDVLDWL 256
            ||||...:      .|.||.|||.||.....||||..|....||:
 Frog   260 GGPLTCQDPISKQYVLYGITSWGDGCGERGKPGVYTRVTAFTDWI 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 83/232 (36%)
Tryp_SPc 36..259 CDD:238113 84/234 (36%)
prss56XP_017949880.1 Tryp_SPc 75..305 CDD:238113 84/234 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.