DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and LOC101730924

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_031761513.1 Gene:LOC101730924 / 101730924 -ID:- Length:243 Species:Xenopus tropicalis


Alignment Length:260 Identity:84/260 - (32%)
Similarity:130/260 - (50%) Gaps:21/260 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RILVVFLVLGVGCSLADPIYRNEEVHIPKLDGRIVGGQDTNITQYPHQISMRYRGNHRCGGTIYR 67
            ::|::.::||...:..              |.:|:||........|:.:|:. .|.|.|||::..
 Frog     2 KLLLLCVLLGAAAAFD--------------DDKIIGGATCAKNSVPYIVSLN-SGYHFCGGSLIN 51

  Fly    68 SNQIISAAHCVNTLSGPENLTIVAGSSNIWFPTGPQQELEVREIIIHPKYRTLNNDYDAAILILD 132
            :..::|||||...     ::.:..|..||....|.:|.:...::|.|..|.:...|.|..::.|.
 Frog    52 NQWVVSAAHCYKA-----SIQVRLGEHNIALSEGTEQFISSSKVIRHSGYNSWTLDNDIMLIKLS 111

  Fly   133 GDFEFNDAVQPIELAKERPDHDTPVTVTGWGTT-SEGGTISDVLQEVSVNVVDNSNCKNAYSIML 196
            .....|.||..:.|........|...::|||.| |.|....|:||.:...::.::.|.|||...:
 Frog   112 SAASLNAAVNAVALPSGCAAAGTSCLISGWGNTLSSGSNYPDLLQCLYAPILTDAQCNNAYPGEI 176

  Fly   197 TSRMLCAGVNGGGKDACQGDSGGPLVYNNTLLGIVSWGTGCAREKYPGVYCSVPDVLDWLVETVA 261
            |:.|:|.|...||||:||||||||:|.|..|.|:||||.|||:..|||||..|.:...|:..|:|
 Frog   177 TNNMICLGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGYGCAQRNYPGVYTKVCNYNSWIQSTIA 241

  Fly   262  261
             Frog   242  241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 77/220 (35%)
Tryp_SPc 36..259 CDD:238113 78/223 (35%)
LOC101730924XP_031761513.1 Tryp_SPc 21..239 CDD:238113 78/223 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.