DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and ovch2

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_031756362.1 Gene:ovch2 / 100496902 XenbaseID:XB-GENE-955935 Length:1023 Species:Xenopus tropicalis


Alignment Length:261 Identity:87/261 - (33%)
Similarity:135/261 - (51%) Gaps:33/261 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSSNIWFP 99
            |||||:::...|:|..:|::..|.|.|||.:.....:::|:||:...:....:.:..|..:....
 Frog    63 RIVGGRESKKGQHPWTVSLKRNGKHFCGGILVSRRHVLTASHCLLDRNVKSYIRVFFGEYDQTIK 127

  Fly   100 TGPQQELEVREIIIHPKYR-TLNNDYDAAILILDGDFEFNDAVQPIELAKERPDH-----DTPVT 158
            ...:|..:|.||..||.:. |...:||.|:|:|||...|:|.:||  .....||.     |..||
 Frog   128 EDTEQTFKVIEIFKHPDFNYTQPMNYDVAVLVLDGAVTFDDNIQP--ACMPNPDDVFEPGDLCVT 190

  Fly   159 VTGWGTTSEGGTISDVLQEVSVNVVDNSNCKNAYSIM----LTSRMLCAGVNGGGKDACQGDSGG 219
            : |||..:|.|.:..|||||.:.:|:.|.|.:..:.:    ::|:::|||...||||||||||||
 Frog   191 L-GWGHLTENGILPGVLQEVLLPLVNLSICLDVMATLKGAVVSSKIVCAGFPEGGKDACQGDSGG 254

  Fly   220 PLVYNN-----TLLGIVSWGTGCA------------REKYPGVYCSVPDVLDWL---VETVADKE 264
            ||:...     .|.|:.|||.||.            |:..||::..:..:|.|:   :.|...||
 Frog   255 PLLCQRRHGTWVLHGLTSWGMGCGRSWKNNMFLPANRKGSPGIFTDIQKLLGWVSFQLNTAVTKE 319

  Fly   265 S 265
            |
 Frog   320 S 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 82/246 (33%)
Tryp_SPc 36..259 CDD:238113 82/252 (33%)
ovch2XP_031756362.1 Tryp_SPc 64..309 CDD:238113 82/247 (33%)
CUB 330..436 CDD:238001
CUB 447..558 CDD:238001
Tryp_SPc 606..832 CDD:238113
CUB 888..1000 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.