DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and f12

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_017947702.2 Gene:f12 / 100493769 XenbaseID:XB-GENE-1004811 Length:597 Species:Xenopus tropicalis


Alignment Length:243 Identity:88/243 - (36%)
Similarity:125/243 - (51%) Gaps:19/243 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PKLDGRIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSS 94
            |.:..|||||.......:|: |:..|..||.|||::.....|::||||::.......:::|.|.|
 Frog   353 PSIMPRIVGGLVALPASHPY-IAALYIDNHFCGGSLISPCWIVTAAHCLDQRPNVTKISVVLGQS 416

  Fly    95 NIWFPTGPQQ--ELEVREIIIHPKYRTLNNDYDAAIL---ILDG--DFEFNDAVQPIELAKE--R 150
            .  |.|..|.  .|.|.:.|:|.||......:|.|::   .::|  ..||:..||||.|.::  .
 Frog   417 R--FNTTDQHTVTLLVEKYILHEKYYGDTLQHDIALVKVKSINGLCASEFSQFVQPICLPQQFKM 479

  Fly   151 PDHDTPVTVTGWGTTSEGGT-ISDVLQEVSVNVVDNSNCK--NAYSIMLTSRMLCAGVNGGGKDA 212
            .:......|.|||...||.. .:..|||.|:.::..:.|:  :.:...:...|||||...||.||
 Frog   480 AESTKQCVVAGWGHQYEGAEHYAFFLQEASMPIIPYTQCQSPSVHGDRMLPGMLCAGFMEGGVDA 544

  Fly   213 CQGDSGGPLVY----NNTLLGIVSWGTGCAREKYPGVYCSVPDVLDWL 256
            ||||||||||.    ...|.|:||||:|||.|..||||.:|....||:
 Frog   545 CQGDSGGPLVCEVDGRIELHGVVSWGSGCAEENKPGVYTAVTSYTDWI 592

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 85/235 (36%)
Tryp_SPc 36..259 CDD:238113 86/237 (36%)
f12XP_017947702.2 fn2 46..87 CDD:394995
EGF_CA 95..129 CDD:238011
KR 213..298 CDD:214527
Tryp_SPc 359..595 CDD:238113 86/237 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.