DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and LOC100485189

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_002941065.2 Gene:LOC100485189 / 100485189 -ID:- Length:249 Species:Xenopus tropicalis


Alignment Length:230 Identity:85/230 - (36%)
Similarity:116/230 - (50%) Gaps:8/230 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSSNIWFP 99
            ||:||.:......|...|:.|...|.|||.:...|.:::||||  .||   :|.:..|..|:...
 Frog    21 RIIGGTECRPNSQPWHCSLYYFDQHVCGGVLIDENWVLTAAHC--QLS---SLQVRLGEHNLAVY 80

  Fly   100 TGPQQELEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIELAKERPDHDTPVTVTGWG- 163
            .|.:|.....::..|..:..:..|.|..:|.|......||.||.|.|............|:||| 
 Frog    81 EGKEQFSYAEKMCPHSGFNPITFDNDIMLLKLVSPVTINDYVQTIPLGCPTVGDGETCLVSGWGT 145

  Fly   164 TTSEGGTISDVLQEVSVNVVDNSNCKNAY-SIMLTSRMLCAGVNGGGKDACQGDSGGPLVYNNTL 227
            |||...|..|.||.|.|..|....|:.|: :..:|..||||||..||||:||||||||||.|:.:
 Frog   146 TTSPEETFPDELQCVEVQTVSQDYCQGAFPTDEITDNMLCAGVMEGGKDSCQGDSGGPLVCNSMV 210

  Fly   228 LGIVSWG-TGCAREKYPGVYCSVPDVLDWLVETVA 261
            .||.||| |.|.....||:|..:.:.:.|:.:|:|
 Frog   211 HGITSWGNTPCGVANKPGIYTKICNYIAWIQDTIA 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 82/222 (37%)
Tryp_SPc 36..259 CDD:238113 82/225 (36%)
LOC100485189XP_002941065.2 Tryp_SPc 22..243 CDD:238113 82/225 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.