DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and tmprss11f

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_004911133.1 Gene:tmprss11f / 100379970 XenbaseID:XB-GENE-1012399 Length:427 Species:Xenopus tropicalis


Alignment Length:236 Identity:81/236 - (34%)
Similarity:134/236 - (56%) Gaps:14/236 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PKLDGRIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGSS 94
            |.:..|||||.:..:..:|.|.|:|..|:|.||.::.....:::||||.:..:...:.|:|.|:.
 Frog   191 PSVSNRIVGGTNAGLGSWPWQASLRLLGSHTCGASLLNDTWLVAAAHCFDMNADANSWTVVLGTI 255

  Fly    95 NIWFPTGPQQELEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPI---ELAKERPDHDTP 156
            |::  :|  .|.::.:|||:..|.:.|:..|.|:|.|.....|...::|:   |.:...|| .:.
 Frog   256 NVY--SG--SEFKIEKIIIYEGYTSHNHRNDIALLKLFTPLNFTSIIRPVCLPEASDIFPD-GSS 315

  Fly   157 VTVTGWGTTSEGGTISDVLQEVSVNVVDNSNCKNA--YSIMLTSRMLCAGVNGGGKDACQGDSGG 219
            ..:||||..::||:.|.|||:..|.::::..|.::  |..::...|:|||...|..|:|||||||
 Frog   316 CYITGWGALTDGGSASQVLQQAEVKIINSDTCSSSQMYGGLIYPSMICAGYATGQIDSCQGDSGG 380

  Fly   220 PLVYNNT----LLGIVSWGTGCAREKYPGVYCSVPDVLDWL 256
            |||...:    |:||||:|.|||....||||..:..:.:|:
 Frog   381 PLVTLKSGRWVLIGIVSFGYGCALPNKPGVYSRITYLRNWI 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 79/228 (35%)
Tryp_SPc 36..259 CDD:238113 79/230 (34%)
tmprss11fXP_004911133.1 SEA 48..148 CDD:396113
Tryp_SPc 197..421 CDD:238113 78/228 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.