DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and LOC100361261

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_038949773.1 Gene:LOC100361261 / 100361261 -ID:- Length:248 Species:Rattus norvegicus


Alignment Length:246 Identity:76/246 - (30%)
Similarity:110/246 - (44%) Gaps:29/246 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PKLD-GRIVGGQDTNITQYPH----QISMRYRGNHRCGGTIYRSNQIISAAHCVNTLSGPENLTI 89
            ||.| |.|:||.:......|:    ||.....||..|||.:.|...:::||||:.:      :.:
  Rat    14 PKTDAGEIIGGHEAKPHSRPYMAYLQIMDENSGNKTCGGFLIREYFVLTAAHCLGS-----XIIV 73

  Fly    90 VAGSSNIWFPTGPQQELEVREIIIHPKY--RTLNNDYDAAILILDGDFEFNDAVQPIEL----AK 148
            ..|:.||......||.:.:.:||.||.|  :|::|  |..:|.|....:...||:.:.|    .|
  Rat    74 TLGAHNIKEQEKKQQVIPMVKIIPHPAYNAKTISN--DLMLLKLKIKAKKTSAVKTLNLPRSNVK 136

  Fly   149 ERPDHDTPVTVTGWGTTSEGGTISDVLQEVSVNVVDNSNCK----NAYSIMLTSRMLCAGVNGGG 209
            .:|  .....|.|||.....|...|.||||.:.|.::..|:    |.|.   .:...|||.....
  Rat   137 VKP--GDVCYVAGWGKLGPMGKFPDTLQEVELIVQEDQKCESYLTNVYD---KANEKCAGEPKIK 196

  Fly   210 KDACQGDSGGPLVYNNTLLGIVSWGTGCAREKYPGVYCSVPDVLDWLVETV 260
            ..:.|||||||||......||||:  ||.....|..:..|...|..:.:|:
  Rat   197 HASFQGDSGGPLVCKKVAAGIVSY--GCKDGSTPRAFTKVSTFLSRIKKTM 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 71/233 (30%)
Tryp_SPc 36..259 CDD:238113 71/236 (30%)
LOC100361261XP_038949773.1 Tryp_SPc 21..244 CDD:238113 71/236 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.