DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and LOC100331291

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_009295692.1 Gene:LOC100331291 / 100331291 -ID:- Length:932 Species:Danio rerio


Alignment Length:247 Identity:92/247 - (37%)
Similarity:128/247 - (51%) Gaps:27/247 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PKLDGRIVGGQDTNITQYPHQISMRY-RGNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIVAGS 93
            |:...:||||.|.....:|.|:|::. |..|.||.::..|..::|||||..     ::..|....
Zfish   685 PRKRAKIVGGTDAQAGSWPWQVSLQMERYGHVCGASLVASRWLVSAAHCFQ-----DSDAIKYSD 744

  Fly    94 SNIW----------FPTGPQQELEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIELAK 148
            :..|          ..:......::|.|::|.:|....:|||.|:|.|.....||:.|||:  ..
Zfish   745 ARSWRAYMGMRVMNSVSNAAATRQIRRIVLHSQYDQFTSDYDIALLELSAPVFFNELVQPV--CV 807

  Fly   149 ERPDH----DTPVTVTGWGTTSEGGTISDVLQEVSVNVVDNSNCKNAYSIMLTSRMLCAGVNGGG 209
            ..|.|    .|...|||||..:|.|.::.:|||.:||:::::.|...|...:|.||||||...||
Zfish   808 PAPSHVFTSGTSCFVTGWGVLTEEGELATLLQEATVNIINHNTCNKMYDDAVTPRMLCAGNIQGG 872

  Fly   210 KDACQGDSGGPLVYNNT-----LLGIVSWGTGCAREKYPGVYCSVPDVLDWL 256
            .||||||||||||....     |.||||||.||||:..||||..|....||:
Zfish   873 VDACQGDSGGPLVCLERGRRWFLAGIVSWGEGCARQNRPGVYTRVIKFTDWI 924

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 89/239 (37%)
Tryp_SPc 36..259 CDD:238113 91/241 (38%)
LOC100331291XP_009295692.1 SEA 136..>220 CDD:307516
CUB 315..415 CDD:238001
CUB 421..528 CDD:238001
LDLa 536..568 CDD:238060
LDLa 606..636 CDD:238060
LDLa 644..679 CDD:238060
Tryp_SPc 691..927 CDD:238113 91/241 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.