DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and tmprss15

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_001919639.2 Gene:tmprss15 / 100148042 ZFINID:ZDB-GENE-091204-83 Length:990 Species:Danio rerio


Alignment Length:246 Identity:89/246 - (36%)
Similarity:123/246 - (50%) Gaps:27/246 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KLDGRIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCVN----TLSGPENLTIVA 91
            |.:||:|||||.....:|..:|:::.|.|.||.|:.....:|:|||||.    .||   |...|.
Zfish   743 KKEGRVVGGQDAQRGAWPWMVSLQWLGGHACGATLIDREWLITAAHCVYGRNVQLS---NWAAVL 804

  Fly    92 GSSNIWFPTGP-QQELEVREIIIHPKYRTLNNDYDAAILILDGDFEFNDAVQPIELAKERPD--- 152
            |....:....| :|...|.::|:|..|.....:.|.|::.|.....:.|.||||.|    ||   
Zfish   805 GLHAQFETINPNKQVFSVDQVIMHKHYNKRTKESDFALMHLKTPVSYTDYVQPICL----PDPGA 865

  Fly   153 ---HDTPVTVTGWGTTSEGGTISDVLQEVSVNVVDNSNCKN---AYSIMLTSRMLCAGVNGGGKD 211
               ......:.|||..||.|..:||||:..|.::.|:.|:.   .|:  .|.||:|||...||.|
Zfish   866 HFEEGRKCFIAGWGLLSESGLKADVLQQAVVPLLSNTQCQEWLPEYN--FTERMMCAGYAEGGVD 928

  Fly   212 ACQGDSGGPLVYNN----TLLGIVSWGTGCAREKYPGVYCSVPDVLDWLVE 258
            .|||||||||:...    .|:|..|:|.||.|.:.||.|..|...:||:.|
Zfish   929 TCQGDSGGPLMCEEEGHWVLVGATSFGIGCGRPQRPGAYARVSQFVDWVAE 979

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 84/237 (35%)
Tryp_SPc 36..259 CDD:238113 86/241 (36%)
tmprss15XP_001919639.2 SEA 19..>89 CDD:279699
LDLa 142..175 CDD:238060
CUB 183..288 CDD:238001
MAM 302..457 CDD:279023
MAM 302..457 CDD:99706
CUB 477..586 CDD:238001
LDLa 596..630 CDD:238060
SRCR_2 653..728 CDD:295335
Tryp_SPc 747..977 CDD:214473 85/238 (36%)
Tryp_SPc 748..980 CDD:238113 86/241 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.