DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and hpn

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_012811934.1 Gene:hpn / 100145343 XenbaseID:XB-GENE-995348 Length:417 Species:Xenopus tropicalis


Alignment Length:260 Identity:99/260 - (38%)
Similarity:132/260 - (50%) Gaps:33/260 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 RIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAHCVNTLSGPENLTIV------AGS 93
            |||||||..:.::|.|:|:||.|.|.|||::..|..:::||||.     ||...||      ||:
 Frog   162 RIVGGQDATLGRWPWQVSLRYDGAHLCGGSLISSEWVLTAAHCF-----PERNRIVSQWRVFAGA 221

  Fly    94 SNIWFPTGPQQELEVREIIIHPKYRT-LN-----NDYDAAILILDGDFEFNDAVQPI---ELAKE 149
            .:...|.|  :.|.|:.||.|..|.. ||     |..|.|::.|......::.:||:   .|.::
 Frog   222 VSQLSPRG--KLLGVKGIIYHSGYLPFLNPDSEENSNDIALVHLASPVTLSEYIQPVCLPALGQQ 284

  Fly   150 RPDHDTPVTVTGWGTTSEGGTISDVLQEVSVNVVDNSNCKNA--YSIMLTSRMLCAGVNGGGKDA 212
            ..|... .||:|||.....|..|::|||.||.::.:|.|...  |...:|.:|.|||...||.||
 Frog   285 IIDGKI-CTVSGWGNLQYYGQQSEILQEASVPIISSSVCNQPEYYMNQITGKMFCAGYAEGGIDA 348

  Fly   213 CQGDSGGPLVYNNT--------LLGIVSWGTGCAREKYPGVYCSVPDVLDWLVETVADKESVGKI 269
            ||||||||.|..:|        |.||||||.|||....||||..|.....|:...:..|..|..|
 Frog   349 CQGDSGGPFVCEDTLSRSSRWRLCGIVSWGIGCAMPNKPGVYAKVDQYQYWIYRAMKTKSDVAGI 413

  Fly   270  269
             Frog   414  413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 95/244 (39%)
Tryp_SPc 36..259 CDD:238113 95/247 (38%)
hpnXP_012811934.1 Hepsin-SRCR 50..159 CDD:370400
Tryp_SPc 163..400 CDD:238113 94/244 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.