DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lambdaTry and zfand4

DIOPT Version :9

Sequence 1:NP_610673.1 Gene:lambdaTry / 36214 FlyBaseID:FBgn0043470 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_012822294.1 Gene:zfand4 / 100144290 XenbaseID:XB-GENE-6258311 Length:701 Species:Xenopus tropicalis


Alignment Length:208 Identity:41/208 - (19%)
Similarity:76/208 - (36%) Gaps:29/208 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LADPIYRNEEV-----HIPKLDGRIVGGQDTNITQYPHQISMRYRGNHRCGGTIYRSNQIISAAH 76
            |.:|.|...:|     |:.|.|  |:...|.::.   || :|.:..|......|..|...::.  
 Frog   324 LENPRYNKNKVLPPVAHLKKKD--ILAMDDDSMF---HQ-NMDFMSNEESSHPITDSFDFLTD-- 380

  Fly    77 CVNTLSGPENLTIVAGSSNIWFPTGPQQELEVREIIIHPKYRTLNND-YDAAILILDGDFEFNDA 140
             |..:....|:..:......:..|..:::....|..:.|..::||.: .|..|...|.....:..
 Frog   381 -VRPIEPFRNVCTIGQVKPEFKLTEGRKDPSATETSLRPVSKSLNPEAMDTGINTSDLSPARSKL 444

  Fly   141 VQPIELAKERPDHDTPVTVTGWGTTSEGG-----TISDVLQEVSV-NVVDNSNCKNAYSIMLTSR 199
            :.|:....: ..|.:|.::.......|.|     |..::.:.|.. |:.|.|..:       |:|
 Frog   445 LTPVNFPSQ-ISHLSPPSLQCQSKCFETGNFRTPTSQNLFRSVEARNIADRSFSR-------TAR 501

  Fly   200 MLCAGVNGGGKDA 212
            .....||..||.:
 Frog   502 FRGVKVNSPGKQS 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lambdaTryNP_610673.1 Tryp_SPc 35..255 CDD:214473 34/185 (18%)
Tryp_SPc 36..259 CDD:238113 34/184 (18%)
zfand4XP_012822294.1 Ubl_ZFAND4 28..101 CDD:340500
ZnF_AN1 641..679 CDD:197545
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.