DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or47b and Or19a

DIOPT Version :9

Sequence 1:NP_523690.3 Gene:Or47b / 36212 FlyBaseID:FBgn0026385 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_525013.2 Gene:Or19a / 59214 FlyBaseID:FBgn0041626 Length:387 Species:Drosophila melanogaster


Alignment Length:385 Identity:68/385 - (17%)
Similarity:141/385 - (36%) Gaps:100/385 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 INLFIMCNVMTIFWTMFVALPESK------NVIEMGDDLV---WISGMALVFTKIFYMHLRCDEI 119
            :||....::.|...::.|.:|.:.      ||..|...::   |:       .::....|.||:.
  Fly    58 VNLLQSNSLETFCESLCVTMPHTLYMLKLINVRRMRGQMISSHWL-------LRLLDKRLGCDDE 115

  Fly   120 DELISDFEYYNRELRPHNIDEEVLGWQRLCYVIES---GLYINCFCLVNFFSAAIFLQPLLGEGK 181
            .::|                  :.|.:|..::..:   ||.......:.:.||:  .:|.|    
  Fly   116 RQII------------------MAGIERAEFIFRTIFRGLACTVVLGIIYISAS--SEPTL---- 156

  Fly   182 LPFHSVYPFQWHRLDLHPYTFWFLYIWQSLTSQHNLMSILMVD--------MVGISTFLQTALNL 238
                 :||            .|..:.|:..||.:...::|...        ::.:|::..|.|.|
  Fly   157 -----MYP------------TWIPWNWRDSTSAYLATAMLHTTALMANATLVLNLSSYPGTYLIL 204

  Fly   239 -----KLLCIEIRKLG-DMEVSDKRFHEEFCRVVRFHQHIIKLVGKANRAFNGAFNAQLMAS--- 294
                 |.|.:.:.||| ...:...|........:..||.|::|.....|:.:.....|..::   
  Fly   205 VSVHTKALALRVSKLGYGAPLPAVRMQAILVGYIHDHQIILRLFKSLERSLSMTCFLQFFSTACA 269

  Fly   295 ---------FSLISISTFETMAAAAVDPKMAAKFVLLMLVAFIQLSLWCVSGTLVYTQSVEVAQA 350
                     |..:.|..|..|             :.|:::...:..|.|.:..|...:...:..|
  Fly   270 QCTICYFLLFGNVGIMRFMNM-------------LFLLVILTTETLLLCYTAELPCKEGESLLTA 321

  Fly   351 AFDINDWHTKSPGIQRDISFVILRAQKPLMYVAEPFLPFTLGTYMLVLKNCYRLLALMQE 410
            .:..| |.::|...:|.:..::.|.|.|::.|:...:|.::.|:.:::|..|.:|.|:.|
  Fly   322 VYSCN-WLSQSVNFRRLLLLMLARCQIPMILVSGVIVPISMKTFTVMIKGAYTMLTLLNE 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or47bNP_523690.3 7tm_6 88..402 CDD:251636 59/345 (17%)
Or19aNP_525013.2 7tm_6 65..372 CDD:251636 62/368 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465263
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.