DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or47b and Or94a

DIOPT Version :9

Sequence 1:NP_523690.3 Gene:Or47b / 36212 FlyBaseID:FBgn0026385 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_524455.1 Gene:Or94a / 42711 FlyBaseID:FBgn0039033 Length:387 Species:Drosophila melanogaster


Alignment Length:379 Identity:82/379 - (21%)
Similarity:147/379 - (38%) Gaps:68/379 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 LASLPL------YRWINLFIMCNVMTIFWTMFVALPESKNVIEMGDDLVWISGMALVFTKIFYMH 113
            |..||:      ..|:..||..|           |.::..|:.|.     |:.||||...:...|
  Fly    47 LLHLPITFTFIGLMWLEAFISSN-----------LEQAGQVLYMS-----ITEMALVVKILSIWH 95

  Fly   114 LRCD------EIDELISDFEYYNRELRPHNIDEEVLGWQR---------LCYVIES--GLYINCF 161
            .|.:      |:.. ..|::.:|:        |||..|:|         ..|::.|  .:|..| 
  Fly    96 YRTEAWRLMYELQH-APDYQLHNQ--------EEVDFWRREQRFFKWFFYIYILISLGVVYSGC- 150

  Fly   162 CLVNFFSAAIFLQPLLGEG-KLPFHSVYPFQWHRLDLHPYTFWFLYIWQSLTSQHNLMSILMVDM 225
                  :..:||     || :|||....||:|.    :...:||.|.:.........:|.:.:|.
  Fly   151 ------TGVLFL-----EGYELPFAYYVPFEWQ----NERRYWFAYGYDMAGMTLTCISNITLDT 200

  Fly   226 VGISTFLQTALNLKLLCIEIRKLGDMEVSDKRFHEEFCRVVRFHQHIIKLVGKANRAFNGAFNAQ 290
            :|.......:|..:||.:.:|:..:|: :|..|.::...:...||.|..|.....|..:....:|
  Fly   201 LGCYFLFHISLLYRLLGLRLRETKNMK-NDTIFGQQLRAIFIMHQRIRSLTLTCQRIVSPYILSQ 264

  Fly   291 LMASFSLISISTFETMAAAAVD-PKMAAKFVLLMLVAFIQLSLWCVSGTLVYTQSVEVAQAAFDI 354
            ::.|..:|..|.:........| |......:..:.|..:|:.|.|..|..:...:.::....:..
  Fly   265 IILSALIICFSGYRLQHVGIRDNPGQFISMLQFVSVMILQIYLPCYYGNEITVYANQLTNEVYHT 329

  Fly   355 NDWHTKSPGIQRDISFVILRAQKPLMYVAEPFLPFTLGTYMLVLKNCYRLLALM 408
            | |....|.|::.::..:...:||:...|..|....|..::..:.|.|..|||:
  Fly   330 N-WLECRPPIRKLLNAYMEHLKKPVTIRAGNFFAVGLPIFVKTINNAYSFLALL 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or47bNP_523690.3 7tm_6 88..402 CDD:251636 70/332 (21%)
Or94aNP_524455.1 7tm_6 69..376 CDD:251636 72/349 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465471
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.