DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or47b and Or85d

DIOPT Version :9

Sequence 1:NP_523690.3 Gene:Or47b / 36212 FlyBaseID:FBgn0026385 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_524281.1 Gene:Or85d / 41011 FlyBaseID:FBgn0037594 Length:412 Species:Drosophila melanogaster


Alignment Length:417 Identity:95/417 - (22%)
Similarity:179/417 - (42%) Gaps:45/417 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 RSVLRQESPGLIPRLAFY-YVRAF-LSL-LCQYPNK---KLASLPLYRWINLFIMCNVMTIFWT- 78
            :|...||....||..:|. |...| ||: :..|.:|   |...: |..|..:..|.|:.|:..: 
  Fly     8 QSAKEQEKLKAIPLHSFLKYANVFYLSIGMMAYDHKYSQKWKEV-LLHWTFIAQMVNLNTVLISE 71

  Fly    79 ---MFVALPESKNVIEMGDDLVWISGMALVFTKIFYMHLRCDEIDELISDFEYYN----RELRPH 136
               :|:|:.:..|.:|...:|.:|..:.:...||:.:..:...:.:::|..|..:    .:..|:
  Fly    72 LIYVFLAIGKGSNFLEATMNLSFIGFVIVGDFKIWNISRQRKRLTQVVSRLEELHPQGLAQQEPY 136

  Fly   137 NIDEEVLGWQRLC--YVIESGLYINCFCLVNFFSAAIFL--QPLLG----EGKLPFHSVYPFQWH 193
            ||...:.|:.|..  |.   |:::......|.:.|..:|  ...||    |..||::...|:.|.
  Fly   137 NIGHHLSGYSRYSKFYF---GMHMVLIWTYNLYWAVYYLVCDFWLGMRQFERMLPYYCWVPWDWS 198

  Fly   194 RLDLHPYTFWFLYIWQSLTSQHNLMSILMVDMVGISTFLQTALNLKLLCIEIRK----LGDMEVS 254
            .    .|:::|:||.|::..|..|...|..||:..:......::...|...|..    :|..:  
  Fly   199 T----GYSYYFMYISQNIGGQACLSGQLAADMLMCALVTLVVMHFIRLSAHIESHVAGIGSFQ-- 257

  Fly   255 DKRFHE-EFCR-VVRFHQHIIKLVGKANRAFNGAFNAQLMASFSLISISTFETMAAAAVDPKMAA 317
                |: ||.: .|.:||.:|.|....|..|..:..:..::|..:|....|:....:.:|  ...
  Fly   258 ----HDLEFLQATVAYHQSLIHLCQDINEIFGVSLLSNFVSSSFIICFVGFQMTIGSKID--NLV 316

  Fly   318 KFVLLMLVAFIQLSLWCVSGTLVYTQSVEVAQAAFDINDWHTKSPGIQRDISFVILRAQKPLMYV 382
            ..||.:..|.:|:.:.......:...|.::.||.:: :||.......::.:..:|.|||:|....
  Fly   317 MLVLFLFCAMVQVFMIATHAQRLVDASEQIGQAVYN-HDWFRADLRYRKMLILIIKRAQQPSRLK 380

  Fly   383 AEPFLPFTLGTYMLVLKNCYRLLALMQ 409
            |..||..:|.|...:|:..|:..||::
  Fly   381 ATMFLNISLVTVSDLLQLSYKFFALLR 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or47bNP_523690.3 7tm_6 88..402 CDD:251636 72/331 (22%)
Or85dNP_524281.1 7tm_6 84..400 CDD:251636 72/331 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465427
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.