DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or47b and Or85b

DIOPT Version :9

Sequence 1:NP_523690.3 Gene:Or47b / 36212 FlyBaseID:FBgn0026385 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_524279.2 Gene:Or85b / 41007 FlyBaseID:FBgn0037590 Length:390 Species:Drosophila melanogaster


Alignment Length:365 Identity:83/365 - (22%)
Similarity:151/365 - (41%) Gaps:45/365 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 IFWT-----MFVALPES---------KNVIEMGDDLVWISGMALVFTKIFYMHLRCDEIDELISD 125
            :||:     .||.|.||         ...:|....|.:|..:.:..:|:|::..:...|.|||::
  Fly    36 VFWSNVINLSFVGLFESIYVYSAFMDNKFLEAVTALSYIGFVTVGMSKMFFIRWKKTAITELINE 100

  Fly   126 FEYYNRELRPHNIDEE-------VLGWQRLCYVIESGLY------INCFCLVNFFSAAIFLQPLL 177
            .    :|:.|:.:..|       .||......:|.|.||      .|.||::.::....:|...:
  Fly   101 L----KEIYPNGLIREERYNLPMYLGTCSRISLIYSLLYSVLIWTFNLFCVMEYWVYDKWLNIRV 161

  Fly   178 GEGKLPFHSVYPFQWHRLDLHPYTFWFLYIWQSLTSQHNLMSILMVDMVGISTFLQTALNLKLL- 241
            ...:||:....|::|.    ..::::.|...|:.....:....:..|::..:...|..::...| 
  Fly   162 VGKQLPYLMYIPWKWQ----DNWSYYPLLFSQNFAGYTSAAGQISTDVLLCAVATQLVMHFDFLS 222

  Fly   242 -CIEIRKL-GDMEVSDKRFHEEFCRVVRFHQHIIKLVGKANRAFNGAFNAQLMASFSLISISTFE 304
             .:|..:| ||.: .|.||   ...:||:|:.|::|....|..|........|.|..:|....|:
  Fly   223 NSMERHELSGDWK-KDSRF---LVDIVRYHERILRLSDAVNDIFGIPLLLNFMVSSFVICFVGFQ 283

  Fly   305 TMAAAAVDPKMAAKFVLLMLVAFIQLSLWCVSGTLVYTQSVEVAQAAFDINDWHTKSPGIQRDIS 369
              ....|.|.:..|..|.::.:..|:.|.|..|.||...|...:.|.:: ..|:......:|.:.
  Fly   284 --MTVGVPPDIVVKLFLFLVSSMSQVYLICHYGQLVADASYGFSVATYN-QKWYKADVRYKRALV 345

  Fly   370 FVILRAQKPLMYVAEPFLPFTLGTYMLVLKNCYRLLALMQ 409
            .:|.|:||.....|..||..|..|...:|:..|:..||::
  Fly   346 IIIARSQKVTFLKATIFLDITRSTMTDLLQISYKFFALLR 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or47bNP_523690.3 7tm_6 88..402 CDD:251636 73/329 (22%)
Or85bNP_524279.2 7tm_6 64..378 CDD:251636 73/328 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465425
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.