DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or47b and Or85a

DIOPT Version :9

Sequence 1:NP_523690.3 Gene:Or47b / 36212 FlyBaseID:FBgn0026385 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_524277.1 Gene:Or85a / 40991 FlyBaseID:FBgn0037576 Length:397 Species:Drosophila melanogaster


Alignment Length:363 Identity:70/363 - (19%)
Similarity:139/363 - (38%) Gaps:91/363 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 FVALPESKNVIEMGDDLVWISGMALVFTKIFY---------MHLRCDEIDELISDFEYYNRELRP 135
            :|.:|.:.|...|       .|:.::|.:..:         |.:||.:::|.:            
  Fly    84 YVQVPVNTNASIM-------KGIIVLFMRRRFSRAQKMMDAMDIRCTKMEEKV------------ 129

  Fly   136 HNIDEEVLGWQRLC---YVIESGLYINCFCLVNFFSAAIFLQPLLGEGKLPFHSVYPFQWHRLDL 197
                 :|.....||   .||...:|.      .:.|.|  |...|..||.||....|..  ..|.
  Fly   130 -----QVHRAAALCNRVVVIYHCIYF------GYLSMA--LTGALVIGKTPFCLYNPLV--NPDD 179

  Fly   198 HPYTFWFLYIWQSLTSQHNLMSILMVDMVGISTFLQTALNLKLLCIEIRKL-GDMEVSDKRFHEE 261
            |   |:.....:|:|....:::.|::|:..|...:...::::||...|:.| .|:|..|.:.:.|
  Fly   180 H---FYLATAIESVTMAGIILANLILDVYPIIYVVVLRIHMELLSERIKTLRTDVEKGDDQHYAE 241

  Fly   262 FCRVVRFHQHIIKLVGKANRAFNGA------FNAQLMASFSLISISTFETMAAAAVDPKMAAKFV 320
            ....|:.|:.|:: .|...|....|      .:..|:...:.:|:..:.|:....|    :..:.
  Fly   242 LVECVKDHKLIVE-YGNTLRPMISATMFIQLLSVGLLLGLAAVSMQFYNTVMERVV----SGVYT 301

  Fly   321 LLML-----VAFI--QLSLWC--VSGTLVYTQSVEVAQAAFDINDWHTKSPGIQR----DISFVI 372
            :.:|     ..::  |||..|  ::.||                 :|:|..|.:|    .:.:.|
  Fly   302 IAILSQTFPFCYVCEQLSSDCESLTNTL-----------------FHSKWIGAERRYRTTMLYFI 349

  Fly   373 LRAQKPLMYVAEPFLPFTLGTYMLVLKNCYRLLALMQE 410
            ...|:.:::.|....|..|.|.:.:.|..:.::.::.|
  Fly   350 HNVQQSILFTAGGIFPICLNTNIKMAKFAFSVVTIVNE 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or47bNP_523690.3 7tm_6 88..402 CDD:251636 67/345 (19%)
Or85aNP_524277.1 7tm_6 77..379 CDD:251636 69/353 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465270
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.