DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or47b and Orco

DIOPT Version :9

Sequence 1:NP_523690.3 Gene:Or47b / 36212 FlyBaseID:FBgn0026385 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_001097687.1 Gene:Orco / 40650 FlyBaseID:FBgn0037324 Length:486 Species:Drosophila melanogaster


Alignment Length:143 Identity:29/143 - (20%)
Similarity:58/143 - (40%) Gaps:12/143 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 VRFHQHIIKLVGKANRAFNGAFNAQLMASFSLISISTFETMAAAAVDPKMAAKFVLLMLVAFIQL 330
            |..|:|:::||......:..|....::.|...:::..::......|: ..|...|..:..|..|:
  Fly   342 VERHKHVVRLVAAIGDTYGAALLLHMLTSTIKLTLLAYQATKINGVN-VYAFTVVGYLGYALAQV 405

  Fly   331 SLWCVSGTLVYTQSVEVAQAAFDINDWHTKSPGIQRDISFVILRAQKPLMYVAEPFLPFTLG--- 392
            ..:|:.|..:..:|..|.:||:..: |:..|...:..:..|..:.||.:......|...:|.   
  Fly   406 FHFCIFGNRLIEESSSVMEAAYSCH-WYDGSEEAKTFVQIVCQQCQKAMSISGAKFFTVSLDLFA 469

  Fly   393 -------TYMLVL 398
                   ||.:||
  Fly   470 SVLGAVVTYFMVL 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or47bNP_523690.3 7tm_6 88..402 CDD:251636 29/143 (20%)
OrcoNP_001097687.1 7tm_6 70..472 CDD:251636 25/131 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.