DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or47b and Or74a

DIOPT Version :9

Sequence 1:NP_523690.3 Gene:Or47b / 36212 FlyBaseID:FBgn0026385 Length:412 Species:Drosophila melanogaster
Sequence 2:NP_524123.1 Gene:Or74a / 39929 FlyBaseID:FBgn0036709 Length:404 Species:Drosophila melanogaster


Alignment Length:385 Identity:73/385 - (18%)
Similarity:142/385 - (36%) Gaps:107/385 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LAFYYVRAFLSLLCQYPNKKLASLP----LYRWIN-LFIMCNVMTIFWTMFVALPESKNVIEMGD 94
            ::|:..|..|      |..:||.:|    |||.:| :.......:..||:|:            |
  Fly     1 MSFHRYRPRL------PGGELAPMPWPVSLYRVLNHVAWPLEAESGRWTVFL------------D 47

  Fly    95 DLVWISGMALVFTK----------------------------IFYMHLRC-------DEIDELIS 124
            .|:...|. |||.:                            :..|.:||       |....|:.
  Fly    48 RLMIFLGF-LVFCEHNEVDFHYLIANRQDMDNMLTGLPTYLILVEMQIRCFQLAWHKDRFRALLQ 111

  Fly   125 DFE---YYNRELRPH---NIDEEVLGWQRLCYVIESGLYINCFCLVNFFSAAIFLQPLLGEGKLP 183
            .|.   |.:.|:.||   :|..::|..:     :.|.:|:  ..|:|||...: ...:....::.
  Fly   112 RFYAEIYVSEEMEPHLFASIQRQMLATR-----VNSTVYL--LALLNFFLVPV-TNVIYHRREML 168

  Fly   184 FHSVYPFQWHRLDLHPY------TFWFLYIWQS-LTSQHNLMSILMVDMVGISTFLQTALNLKLL 241
            :..||||.  ...||.:      .||..:|..| |..:.|:|..||:.:  .:.::|...:|:..
  Fly   169 YKQVYPFD--NTQLHFFIPLLVLNFWVGFIITSMLFGELNVMGELMMHL--NARYIQLGQDLRRS 229

  Fly   242 C-IEIRKLGDMEVSDKRFHEEFCRVVRFHQHIIKLVGKANRAFNGAFNAQLMASFSLISISTFET 305
            . :.::|...:.|:           :.:..::..:: :.|.|... |..::...|:|.....|..
  Fly   230 AQMLLKKSSSLNVA-----------IAYRLNLTHIL-RRNAALRD-FGQRVEKEFTLRIFVMFAF 281

  Fly   306 MAA--------AAVDPKMAAKFVLLMLVAFIQLSLWCVSGTLVYTQSVEVAQAAFDINDW 357
            .|.        |..:|.....:::..|..|::|....:.|:::...:.|:....:.. ||
  Fly   282 SAGLLCALFFKAFTNPWGNVAYIVWFLAKFMELLALGMLGSILLKTTDELGMMYYTA-DW 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or47bNP_523690.3 7tm_6 88..402 CDD:251636 59/327 (18%)
Or74aNP_524123.1 7tm_6 75..394 CDD:251636 53/292 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465433
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.